Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 106622..107358 | Replicon | plasmid pVIR_Kpn154 |
Accession | NZ_LR745043 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | GW691_RS26310 | Protein ID | WP_004098919.1 |
Coordinates | 106622..107104 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | GW691_RS26315 | Protein ID | WP_004213599.1 |
Coordinates | 107092..107358 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GW691_RS26290 | 101976..103322 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
GW691_RS26295 | 103386..104408 | + | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
GW691_RS26300 | 104583..104978 | + | 396 | Protein_115 | DDE-type integrase/transposase/recombinase | - |
GW691_RS26305 | 104974..106201 | - | 1228 | Protein_116 | IS3 family transposase | - |
GW691_RS26310 | 106622..107104 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
GW691_RS26315 | 107092..107358 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
GW691_RS26320 | 107554..107784 | - | 231 | WP_004213598.1 | hypothetical protein | - |
GW691_RS26325 | 107798..108001 | - | 204 | WP_004213596.1 | hemolysin expression modulator Hha | - |
GW691_RS26330 | 108062..108556 | - | 495 | WP_004213594.1 | hypothetical protein | - |
GW691_RS26335 | 108598..111567 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
GW691_RS26340 | 111570..112127 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..215306 | 215306 | |
- | inside | IScluster/Tn | - | - | 104974..112127 | 7153 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T289039 WP_004098919.1 NZ_LR745043:c107104-106622 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |