Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 69366..70276 Replicon plasmid pVIR_Kpn154
Accession NZ_LR745043
Organism Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154

Toxin (Protein)


Gene name - Uniprot ID A0A7D3P3P5
Locus tag GW691_RS26125 Protein ID WP_023302799.1
Coordinates 69806..70276 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag GW691_RS26120 Protein ID WP_004026357.1
Coordinates 69366..69809 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GW691_RS26090 64384..64905 + 522 WP_004213635.1 sigma-70 family RNA polymerase sigma factor -
GW691_RS26095 64902..65855 + 954 Protein_73 fec operon regulator FecR -
GW691_RS26100 65942..68068 + 2127 WP_004213640.1 TonB-dependent receptor family protein -
GW691_RS26105 68143..68298 + 156 WP_004213642.1 hypothetical protein -
GW691_RS26110 68443..68664 + 222 WP_004213643.1 DUF2188 domain-containing protein -
GW691_RS26115 68762..69265 + 504 Protein_77 DUF4113 domain-containing protein -
GW691_RS26120 69366..69809 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
GW691_RS26125 69806..70276 + 471 WP_023302799.1 RES family NAD+ phosphorylase Toxin
GW691_RS26130 70310..71007 + 698 Protein_80 IS1 family transposase -
GW691_RS26135 72393..73342 - 950 Protein_81 DUF1173 family protein -
GW691_RS26140 73520..74014 + 495 WP_004212794.1 thermonuclease family protein -
GW691_RS26145 74351..74749 + 399 WP_004212796.1 H-NS histone family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..215306 215306
- flank IS/Tn - - 70504..71007 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-138)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17461.84 Da        Isoelectric Point: 4.4411

>T289038 WP_023302799.1 NZ_LR745043:69806-70276 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIVWVHHILVMLPTY

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT289038 WP_004026357.1 NZ_LR745043:69366-69809 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D3P3P5

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References