289037

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 18709..19379 Replicon plasmid pVIR_Kpn154
Accession NZ_LR745043
Organism Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag GW691_RS25835 Protein ID WP_004213072.1
Coordinates 18936..19379 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag GW691_RS25830 Protein ID WP_004213073.1
Coordinates 18709..18939 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GW691_RS25805 14762..15730 + 969 WP_011154535.1 IS5 family transposase -
GW691_RS25810 15821..16111 - 291 WP_004213078.1 hypothetical protein -
GW691_RS25815 16463..16669 + 207 WP_004213077.1 hypothetical protein -
GW691_RS25820 16659..16952 - 294 WP_004213076.1 hypothetical protein -
GW691_RS25825 16968..18101 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
GW691_RS25830 18709..18939 + 231 WP_004213073.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
GW691_RS25835 18936..19379 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
GW691_RS25840 19393..19809 - 417 Protein_22 restriction endonuclease -
GW691_RS25845 19813..20106 - 294 Protein_23 transposase -
GW691_RS27335 20523..21157 + 635 Protein_24 response regulator -
GW691_RS25855 21670..22076 - 407 Protein_25 GAF domain-containing protein -
GW691_RS25860 22167..23087 - 921 WP_004213934.1 DUF1471 domain-containing protein -
GW691_RS25865 23136..23627 - 492 WP_011251327.1 DM13 domain-containing protein -
GW691_RS25870 23690..23965 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB 1..215306 215306
- flank IS/Tn - - 14762..15730 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T289037 WP_004213072.1 NZ_LR745043:18936-19379 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT289037 WP_004213073.1 NZ_LR745043:18709-18939 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References