Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4690506..4691022 | Replicon | chromosome |
Accession | NZ_LR745042 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | GW691_RS23035 | Protein ID | WP_004178374.1 |
Coordinates | 4690506..4690790 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | GW691_RS23040 | Protein ID | WP_002886901.1 |
Coordinates | 4690780..4691022 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GW691_RS23010 | 4685989..4686297 | - | 309 | WP_004210629.1 | PTS sugar transporter subunit IIB | - |
GW691_RS23015 | 4686382..4686555 | + | 174 | WP_004210630.1 | hypothetical protein | - |
GW691_RS23020 | 4686558..4687301 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
GW691_RS23025 | 4687658..4689796 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
GW691_RS23030 | 4690038..4690502 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
GW691_RS23035 | 4690506..4690790 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GW691_RS23040 | 4690780..4691022 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
GW691_RS23045 | 4691100..4693010 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
GW691_RS23050 | 4693033..4694187 | - | 1155 | WP_004210635.1 | lactonase family protein | - |
GW691_RS23055 | 4694254..4694994 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T289034 WP_004178374.1 NZ_LR745042:c4690790-4690506 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |