Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1789263..1789853 | Replicon | chromosome |
Accession | NZ_LR745042 | ||
Organism | Klebsiella pneumoniae isolate Klebsiella pneumoniae kpn154 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A2L1BXX2 |
Locus tag | GW691_RS08720 | Protein ID | WP_022615588.1 |
Coordinates | 1789521..1789853 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3S7DDD0 |
Locus tag | GW691_RS08715 | Protein ID | WP_000288812.1 |
Coordinates | 1789263..1789520 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GW691_RS08695 | 1785599..1787347 | + | 1749 | WP_131312253.1 | hypothetical protein | - |
GW691_RS08700 | 1787426..1787982 | + | 557 | Protein_1678 | hypothetical protein | - |
GW691_RS08705 | 1788265..1788725 | + | 461 | Protein_1679 | hypothetical protein | - |
GW691_RS08710 | 1788722..1788928 | + | 207 | WP_022615589.1 | helix-turn-helix domain-containing protein | - |
GW691_RS08715 | 1789263..1789520 | + | 258 | WP_000288812.1 | antitoxin | Antitoxin |
GW691_RS08720 | 1789521..1789853 | + | 333 | WP_022615588.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
GW691_RS08735 | 1790175..1791611 | + | 1437 | WP_004151469.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
GW691_RS08745 | 1791977..1793431 | - | 1455 | WP_004148975.1 | AMP nucleosidase | - |
GW691_RS08750 | 1793561..1793806 | - | 246 | WP_004141189.1 | signal transduction protein PmrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11913.80 Da Isoelectric Point: 10.1839
>T289025 WP_022615588.1 NZ_LR745042:1789521-1789853 [Klebsiella pneumoniae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDVVVNEVLARLDAMLS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPRTI
DMAARNGKRLERIPDVVVNEVLARLDAMLS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L1BXX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S7DDD0 |