Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 119300..119943 | Replicon | 1 day old chicken plasmid pAPEC2908 |
| Accession | NZ_LR740777 | ||
| Organism | Escherichia coli strain BEN2908 isolate | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | APEC2908_RS25350 | Protein ID | WP_001034044.1 |
| Coordinates | 119527..119943 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | APEC2908_RS25345 | Protein ID | WP_001261286.1 |
| Coordinates | 119300..119530 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC2908_RS25330 | 114717..117809 | - | 3093 | Protein_115 | pcar | - |
| APEC2908_RS25335 | 117865..118562 | + | 698 | Protein_116 | IS1 family transposase | - |
| APEC2908_RS25340 | 118497..118919 | - | 423 | WP_161476339.1 | hypothetical protein | - |
| APEC2908_RS25345 | 119300..119530 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| APEC2908_RS25350 | 119527..119943 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| APEC2908_RS25355 | 120018..121583 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| APEC2908_RS25360 | 121568..122590 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| APEC2908_RS25365 | 122844..123540 | - | 697 | Protein_122 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..152011 | 152011 | |
| - | inside | IScluster/Tn | - | - | 118059..123089 | 5030 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T289022 WP_001034044.1 NZ_LR740777:119527-119943 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |