Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 114029..114672 Replicon 1 day old chicken plasmid pAPEC2908
Accession NZ_LR740777
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag APEC2908_RS25325 Protein ID WP_001034046.1
Coordinates 114256..114672 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag APEC2908_RS25320 Protein ID WP_001261278.1
Coordinates 114029..114259 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS25290 109541..109846 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
APEC2908_RS25295 109848..110066 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
APEC2908_RS25300 110632..111144 + 513 WP_000151784.1 hypothetical protein -
APEC2908_RS25305 111178..112311 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
APEC2908_RS25310 112478..113251 - 774 WP_000905949.1 hypothetical protein -
APEC2908_RS25315 113264..113764 - 501 WP_000528932.1 hypothetical protein -
APEC2908_RS25320 114029..114259 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
APEC2908_RS25325 114256..114672 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
APEC2908_RS25330 114717..117809 - 3093 Protein_115 pcar -
APEC2908_RS25335 117865..118562 + 698 Protein_116 IS1 family transposase -
APEC2908_RS25340 118497..118919 - 423 WP_161476339.1 hypothetical protein -
APEC2908_RS25345 119300..119530 + 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..152011 152011
- inside IScluster/Tn - - 118059..123089 5030


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T289021 WP_001034046.1 NZ_LR740777:114256-114672 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT289021 WP_001261278.1 NZ_LR740777:114029-114259 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References