Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 109541..110066 Replicon 1 day old chicken plasmid pAPEC2908
Accession NZ_LR740777
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag APEC2908_RS25290 Protein ID WP_001159871.1
Coordinates 109541..109846 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag APEC2908_RS25295 Protein ID WP_000813630.1
Coordinates 109848..110066 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS25275 105496..106701 - 1206 WP_001442122.1 AAA family ATPase -
APEC2908_RS25280 107323..108054 + 732 WP_000504262.1 replication initiation protein -
APEC2908_RS25285 108734..109540 - 807 WP_000016968.1 site-specific integrase -
APEC2908_RS25290 109541..109846 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
APEC2908_RS25295 109848..110066 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
APEC2908_RS25300 110632..111144 + 513 WP_000151784.1 hypothetical protein -
APEC2908_RS25305 111178..112311 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
APEC2908_RS25310 112478..113251 - 774 WP_000905949.1 hypothetical protein -
APEC2908_RS25315 113264..113764 - 501 WP_000528932.1 hypothetical protein -
APEC2908_RS25320 114029..114259 + 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
APEC2908_RS25325 114256..114672 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..152011 152011


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T289020 WP_001159871.1 NZ_LR740777:c109846-109541 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT289020 WP_000813630.1 NZ_LR740777:c110066-109848 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References