Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 109541..110066 | Replicon | 1 day old chicken plasmid pAPEC2908 |
| Accession | NZ_LR740777 | ||
| Organism | Escherichia coli strain BEN2908 isolate | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | APEC2908_RS25290 | Protein ID | WP_001159871.1 |
| Coordinates | 109541..109846 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | APEC2908_RS25295 | Protein ID | WP_000813630.1 |
| Coordinates | 109848..110066 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC2908_RS25275 | 105496..106701 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
| APEC2908_RS25280 | 107323..108054 | + | 732 | WP_000504262.1 | replication initiation protein | - |
| APEC2908_RS25285 | 108734..109540 | - | 807 | WP_000016968.1 | site-specific integrase | - |
| APEC2908_RS25290 | 109541..109846 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| APEC2908_RS25295 | 109848..110066 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| APEC2908_RS25300 | 110632..111144 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| APEC2908_RS25305 | 111178..112311 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| APEC2908_RS25310 | 112478..113251 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| APEC2908_RS25315 | 113264..113764 | - | 501 | WP_000528932.1 | hypothetical protein | - |
| APEC2908_RS25320 | 114029..114259 | + | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| APEC2908_RS25325 | 114256..114672 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..152011 | 152011 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T289020 WP_001159871.1 NZ_LR740777:c109846-109541 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |