Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 54606..54982 Replicon 1 day old chicken plasmid pAPEC2908
Accession NZ_LR740777
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name parE Uniprot ID A0A075MDK3
Locus tag APEC2908_RS25000 Protein ID WP_000969988.1
Coordinates 54800..54982 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag APEC2908_RS24995 Protein ID WP_001324224.1
Coordinates 54606..54803 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS24975 49866..50102 + 237 WP_001323890.1 colicin V immunity protein -
APEC2908_RS24980 50080..50391 + 312 WP_001259758.1 colicin V -
APEC2908_RS24985 50561..52675 - 2115 WP_161476333.1 peptidase domain-containing ABC transporter -
APEC2908_RS24990 52650..53924 - 1275 WP_000489608.1 HlyD family secretion protein -
APEC2908_RS24995 54606..54803 + 198 WP_001324224.1 toxin-antitoxin system protein Antitoxin
APEC2908_RS25000 54800..54982 + 183 WP_000969988.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
APEC2908_RS25005 55081..55389 + 309 WP_000377483.1 hypothetical protein -
APEC2908_RS25010 55949..56983 + 1035 WP_001190233.1 3-deoxy-7-phosphoheptulonate synthase -
APEC2908_RS25015 57708..58384 + 677 Protein_52 transposase -
APEC2908_RS25020 58384..58730 + 347 Protein_53 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..152011 152011


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6931.07 Da        Isoelectric Point: 4.5349

>T289013 WP_000969988.1 NZ_LR740777:54800-54982 [Escherichia coli]
MMEIFWTMLASQDRKRIREYIAEQNLIAAIELDERIGCSASLLFSLSFISVQVHDNIITV

Download         Length: 183 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7658.53 Da        Isoelectric Point: 7.2046

>AT289013 WP_001324224.1 NZ_LR740777:54606-54803 [Escherichia coli]
MDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRDEMSRKVAGK

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A075MDK3

Antitoxin

Source ID Structure

References