Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4891688..4892523 Replicon chromosome
Accession NZ_LR740776
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name yeeV Uniprot ID B1LDL9
Locus tag APEC2908_RS23870 Protein ID WP_001094444.1
Coordinates 4892146..4892523 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag APEC2908_RS23865 Protein ID WP_001285607.1
Coordinates 4891688..4892056 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS23825 4887237..4888121 + 885 WP_000010392.1 50S ribosome-binding GTPase -
APEC2908_RS23830 4888240..4888917 + 678 WP_001097368.1 hypothetical protein -
APEC2908_RS23835 4888923..4889156 + 234 WP_001278287.1 DUF905 family protein -
APEC2908_RS23840 4889246..4890064 + 819 WP_001175153.1 DUF945 domain-containing protein -
APEC2908_RS23845 4890090..4890230 - 141 WP_161476298.1 hypothetical protein -
APEC2908_RS23850 4890330..4890809 + 480 WP_161476299.1 antirestriction protein -
APEC2908_RS23855 4890824..4891300 + 477 WP_001384029.1 RadC family protein -
APEC2908_RS23860 4891387..4891608 + 222 WP_000692350.1 DUF987 domain-containing protein -
APEC2908_RS23865 4891688..4892056 + 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
APEC2908_RS23870 4892146..4892523 + 378 WP_001094444.1 TA system toxin CbtA family protein Toxin
APEC2908_RS23875 4892520..4893008 + 489 WP_000761685.1 hypothetical protein -
APEC2908_RS23880 4893028..4893225 + 198 WP_001327226.1 DUF957 domain-containing protein -
APEC2908_RS23885 4893310..4893456 + 147 WP_001290178.1 hypothetical protein -
APEC2908_RS23890 4894409..4896445 + 2037 WP_021512607.1 hypothetical protein -
APEC2908_RS23895 4896844..4897023 - 180 WP_001298063.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimB / fimE / fimA / fimI / fimC 4851936..4906582 54646


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14087.02 Da        Isoelectric Point: 7.3523

>T289012 WP_001094444.1 NZ_LR740776:4892146-4892523 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SVCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT289012 WP_001285607.1 NZ_LR740776:4891688-4892056 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B1LDL9

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References