Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4049398..4050263 | Replicon | chromosome |
Accession | NZ_LR740776 | ||
Organism | Escherichia coli strain BEN2908 isolate |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | APEC2908_RS19835 | Protein ID | WP_174235614.1 |
Coordinates | 4049856..4050263 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | APEC2908_RS19830 | Protein ID | WP_001280951.1 |
Coordinates | 4049398..4049766 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC2908_RS19800 | 4046233..4046657 | + | 425 | Protein_3875 | hypothetical protein | - |
APEC2908_RS19805 | 4046763..4046995 | + | 233 | Protein_3876 | DUF905 family protein | - |
APEC2908_RS19810 | 4047095..4047913 | + | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
APEC2908_RS19815 | 4047968..4048453 | + | 486 | WP_161476275.1 | antirestriction protein | - |
APEC2908_RS19820 | 4048469..4048945 | + | 477 | WP_001186724.1 | RadC family protein | - |
APEC2908_RS19825 | 4049014..4049235 | + | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
APEC2908_RS19830 | 4049398..4049766 | + | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
APEC2908_RS19835 | 4049856..4050263 | + | 408 | WP_174235614.1 | TA system toxin CbtA family protein | Toxin |
APEC2908_RS19840 | 4050226..4050714 | + | 489 | WP_001549830.1 | hypothetical protein | - |
APEC2908_RS19845 | 4050726..4050923 | + | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
APEC2908_RS19850 | 4051008..4051853 | + | 846 | WP_097416764.1 | DUF4942 domain-containing protein | - |
APEC2908_RS19855 | 4052446..4052944 | + | 499 | Protein_3886 | hypothetical protein | - |
APEC2908_RS19860 | 4053111..4054034 | + | 924 | WP_001351210.1 | carboxylate/amino acid/amine transporter | - |
APEC2908_RS19865 | 4054038..4054856 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4037480..4052814 | 15334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15204.16 Da Isoelectric Point: 7.2150
>T289008 WP_174235614.1 NZ_LR740776:4049856-4050263 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITTVSIRRNDETFPDAGSRQN
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITTVSIRRNDETFPDAGSRQN
Download Length: 408 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13699.56 Da Isoelectric Point: 7.0268
>AT289008 WP_001280951.1 NZ_LR740776:4049398-4049766 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|