Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2106047..2106878 Replicon chromosome
Accession NZ_LR740776
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag APEC2908_RS10400 Protein ID WP_000854814.1
Coordinates 2106504..2106878 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag APEC2908_RS10395 Protein ID WP_001285585.1
Coordinates 2106047..2106415 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS10360 2102408..2102754 - 347 Protein_2026 IS66 family insertion sequence element accessory protein TnpB -
APEC2908_RS10365 2102759..2103430 - 672 Protein_2027 transposase -
APEC2908_RS10370 2103488..2103720 + 233 Protein_2028 DUF905 family protein -
APEC2908_RS10375 2103820..2104636 + 817 Protein_2029 DUF945 domain-containing protein -
APEC2908_RS10380 2104718..2105197 + 480 WP_000860087.1 antirestriction protein -
APEC2908_RS10385 2105213..2105689 + 477 WP_039267628.1 RadC family protein -
APEC2908_RS10390 2105752..2105973 + 222 WP_000692323.1 DUF987 domain-containing protein -
APEC2908_RS10395 2106047..2106415 + 369 WP_001285585.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
APEC2908_RS10400 2106504..2106878 + 375 WP_000854814.1 type IV toxin-antitoxin system toxin CbtA Toxin
APEC2908_RS10405 2106875..2107069 + 195 WP_000988600.1 hypothetical protein -
APEC2908_RS10410 2107082..2107195 + 114 WP_001161660.1 DUF957 domain-containing protein -
APEC2908_RS10415 2107484..2107612 - 129 Protein_2037 transposase domain-containing protein -
APEC2908_RS10420 2107684..2107866 + 183 WP_001016348.1 hypothetical protein -
APEC2908_RS10425 2107967..2108296 - 330 WP_000450409.1 DUF496 family protein -
APEC2908_RS10430 2108468..2109526 - 1059 WP_001200891.1 FUSC family protein -
APEC2908_RS10435 2109724..2110197 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
APEC2908_RS10440 2110316..2111482 - 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T289004 WP_000854814.1 NZ_LR740776:2106504-2106878 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT289004 WP_001285585.1 NZ_LR740776:2106047-2106415 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References