Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2106047..2106878 | Replicon | chromosome |
| Accession | NZ_LR740776 | ||
| Organism | Escherichia coli strain BEN2908 isolate | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | APEC2908_RS10400 | Protein ID | WP_000854814.1 |
| Coordinates | 2106504..2106878 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | APEC2908_RS10395 | Protein ID | WP_001285585.1 |
| Coordinates | 2106047..2106415 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC2908_RS10360 | 2102408..2102754 | - | 347 | Protein_2026 | IS66 family insertion sequence element accessory protein TnpB | - |
| APEC2908_RS10365 | 2102759..2103430 | - | 672 | Protein_2027 | transposase | - |
| APEC2908_RS10370 | 2103488..2103720 | + | 233 | Protein_2028 | DUF905 family protein | - |
| APEC2908_RS10375 | 2103820..2104636 | + | 817 | Protein_2029 | DUF945 domain-containing protein | - |
| APEC2908_RS10380 | 2104718..2105197 | + | 480 | WP_000860087.1 | antirestriction protein | - |
| APEC2908_RS10385 | 2105213..2105689 | + | 477 | WP_039267628.1 | RadC family protein | - |
| APEC2908_RS10390 | 2105752..2105973 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| APEC2908_RS10395 | 2106047..2106415 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| APEC2908_RS10400 | 2106504..2106878 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| APEC2908_RS10405 | 2106875..2107069 | + | 195 | WP_000988600.1 | hypothetical protein | - |
| APEC2908_RS10410 | 2107082..2107195 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| APEC2908_RS10415 | 2107484..2107612 | - | 129 | Protein_2037 | transposase domain-containing protein | - |
| APEC2908_RS10420 | 2107684..2107866 | + | 183 | WP_001016348.1 | hypothetical protein | - |
| APEC2908_RS10425 | 2107967..2108296 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| APEC2908_RS10430 | 2108468..2109526 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| APEC2908_RS10435 | 2109724..2110197 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| APEC2908_RS10440 | 2110316..2111482 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T289004 WP_000854814.1 NZ_LR740776:2106504-2106878 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT289004 WP_001285585.1 NZ_LR740776:2106047-2106415 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |