Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 72728..73086 Replicon chromosome
Accession NZ_LR740776
Organism Escherichia coli strain BEN2908 isolate

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag APEC2908_RS00335 Protein ID WP_001332330.1
Coordinates 72964..73086 (+) Length 41 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag APEC2908_RS00330 Protein ID WP_000125566.1
Coordinates 72728..72961 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC2908_RS00305 67801..68088 + 288 WP_000203741.1 ferredoxin-like protein FixX -
APEC2908_RS00310 68147..69478 + 1332 WP_001183207.1 MFS transporter -
APEC2908_RS00315 69586..70116 + 531 WP_000600749.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
APEC2908_RS00320 70109..71971 + 1863 WP_000377122.1 glutathione-regulated potassium-efflux system protein KefC -
APEC2908_RS00325 72163..72642 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
APEC2908_RS00330 72728..72961 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
APEC2908_RS00335 72964..73086 + 123 WP_001332330.1 CcdB family protein Toxin
APEC2908_RS00340 73127..73279 + 153 WP_146692624.1 CcdB family protein -
APEC2908_RS00345 73276..74124 - 849 WP_000257201.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
APEC2908_RS00350 74131..74508 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
APEC2908_RS00355 74511..75332 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
APEC2908_RS00360 75329..76318 - 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
APEC2908_RS00365 76318..77604 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-39)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 41 a.a.        Molecular weight: 4563.34 Da        Isoelectric Point: 10.9266

>T288994 WP_001332330.1 NZ_LR740776:72964-73086 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIVGEINRRIVIPLTPI

Download         Length: 123 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT288994 WP_000125566.1 NZ_LR740776:72728-72961 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References