Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 142845..143370 | Replicon | plasmid paAPEC5202 |
Accession | NZ_LR740759 | ||
Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | APEC5202_RS25580 | Protein ID | WP_001159871.1 |
Coordinates | 143065..143370 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | APEC5202_RS25575 | Protein ID | WP_000813630.1 |
Coordinates | 142845..143063 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
APEC5202_RS25545 | 138239..138655 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
APEC5202_RS25550 | 138652..138882 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
APEC5202_RS25555 | 139147..139647 | + | 501 | WP_000528932.1 | hypothetical protein | - |
APEC5202_RS25560 | 139660..140433 | + | 774 | WP_000905949.1 | hypothetical protein | - |
APEC5202_RS25565 | 140600..141733 | + | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
APEC5202_RS25570 | 141767..142279 | - | 513 | WP_000151784.1 | hypothetical protein | - |
APEC5202_RS25575 | 142845..143063 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
APEC5202_RS25580 | 143065..143370 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
APEC5202_RS25585 | 143371..144177 | + | 807 | WP_000016968.1 | site-specific integrase | - |
APEC5202_RS25590 | 144857..145588 | - | 732 | WP_000504262.1 | replication initiation protein | - |
APEC5202_RS25595 | 146209..147414 | + | 1206 | WP_001442122.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..223939 | 223939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T288982 WP_001159871.1 NZ_LR740759:143065-143370 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |