Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 138239..138882 Replicon plasmid paAPEC5202
Accession NZ_LR740759
Organism Escherichia coli strain BEN5202 isolate laying hen 51 weeks old

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag APEC5202_RS25545 Protein ID WP_001034046.1
Coordinates 138239..138655 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag APEC5202_RS25550 Protein ID WP_001261278.1
Coordinates 138652..138882 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC5202_RS25530 133376..133792 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
APEC5202_RS25535 133789..134019 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
APEC5202_RS25540 134400..138194 + 3795 WP_001144732.1 hypothetical protein -
APEC5202_RS25545 138239..138655 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
APEC5202_RS25550 138652..138882 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
APEC5202_RS25555 139147..139647 + 501 WP_000528932.1 hypothetical protein -
APEC5202_RS25560 139660..140433 + 774 WP_000905949.1 hypothetical protein -
APEC5202_RS25565 140600..141733 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
APEC5202_RS25570 141767..142279 - 513 WP_000151784.1 hypothetical protein -
APEC5202_RS25575 142845..143063 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
APEC5202_RS25580 143065..143370 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / sitABCD vat / iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..223939 223939


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T288981 WP_001034046.1 NZ_LR740759:c138655-138239 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT288981 WP_001261278.1 NZ_LR740759:c138882-138652 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References