Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 4606372..4607360 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | APEC5202_RS26625 | Protein ID | WP_014640052.1 |
| Coordinates | 4606974..4607360 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A0A1AFM1 |
| Locus tag | APEC5202_RS22345 | Protein ID | WP_000458583.1 |
| Coordinates | 4606372..4606944 (+) | Length | 191 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS22320 | 4602534..4602902 | + | 369 | WP_000002899.1 | diacylglycerol kinase | - |
| APEC5202_RS22325 | 4603012..4603620 | + | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
| APEC5202_RS22330 | 4603693..4605018 | + | 1326 | WP_001296637.1 | MATE family efflux transporter DinF | - |
| APEC5202_RS22335 | 4605134..4605343 | + | 210 | WP_001296638.1 | CsbD family protein | - |
| APEC5202_RS22340 | 4605385..4605900 | - | 516 | WP_000416264.1 | zinc uptake transcriptional repressor Zur | - |
| APEC5202_RS22345 | 4606372..4606944 | + | 573 | WP_000458583.1 | SocA family protein | Antitoxin |
| APEC5202_RS26625 | 4606974..4607360 | + | 387 | WP_014640052.1 | hypothetical protein | Toxin |
| APEC5202_RS26770 | 4607400..4607573 | + | 174 | WP_000390072.1 | hypothetical protein | - |
| APEC5202_RS22350 | 4607621..4607902 | - | 282 | WP_001093916.1 | pyocin activator PrtN family protein | - |
| APEC5202_RS22355 | 4607939..4608511 | - | 573 | WP_001061345.1 | 3'-5' exoribonuclease | - |
| APEC5202_RS22360 | 4608511..4609269 | - | 759 | WP_021518219.1 | DUF551 domain-containing protein | - |
| APEC5202_RS22365 | 4609272..4609463 | - | 192 | WP_001014291.1 | hypothetical protein | - |
| APEC5202_RS22370 | 4609465..4610019 | - | 555 | WP_021518220.1 | ead/Ea22-like family protein | - |
| APEC5202_RS22375 | 4610016..4610255 | - | 240 | WP_000476212.1 | hypothetical protein | - |
| APEC5202_RS22380 | 4610248..4610451 | - | 204 | WP_021518221.1 | hypothetical protein | - |
| APEC5202_RS22385 | 4610448..4611326 | - | 879 | WP_021518222.1 | phosphoadenosine phosphosulfate reductase family protein | - |
| APEC5202_RS22390 | 4611317..4611853 | - | 537 | WP_021518223.1 | 5'-deoxynucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4603012..4664622 | 61610 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14465.40 Da Isoelectric Point: 5.4833
>T288972 WP_014640052.1 NZ_LR740758:4606974-4607360 [Escherichia coli]
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
VLAPTGPCNHLHVICNDPVYYPVNDCYCVLVVNISSIKDGVPHDPSCVLNSGDHRFIKHPSYVVYAEAIIWRVDNMVRKQ
RSGEISVHDDMPEATFNRILDGFDISDEVTPKNLKFKNKYCVSSIDDE
Download Length: 387 bp
Antitoxin
Download Length: 191 a.a. Molecular weight: 21956.30 Da Isoelectric Point: 6.0283
>AT288972 WP_000458583.1 NZ_LR740758:4606372-4606944 [Escherichia coli]
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
MFCEEKVAQMAAYLLLKRGGRMAYLKLMKLLYLSNRKSILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYN
LIETNGHDVLLRSDPREMDADEVFDELSRADIRILDEIYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKPIDLKEMLI
SEGKSEDEANRIIGKMEESQKLKEFSLQLS
Download Length: 573 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|