Detailed information of TA system TA288970

Bioinformatically predicted

Overview

TA module

• Type: IV
• Classification (family/domain): yeeUV (cbtA-cbeA)/CbtA-CbeA
• Location: 4004478..4005316
• Replicon: chromosome
• Accession: NZ_LR740758
• Organism: Escherichia coli strain BEN5202 isolate laying hen 51 weeks old

Toxin (Protein)

• Gene name: yeeV
• Uniprot ID: -
• Locus tag: APEC5202_RS19540
• Protein ID: WP_103529922.1
• Coordinates: 4004478..4004858 (-)
• Length: 127 a.a.

Antitoxin (Protein)

• Gene name: yeeU
• Uniprot ID: -
• Locus tag: APEC5202_RS19545
• Protein ID: WP_089519525.1
• Coordinates: 4004948..4005316 (-)
• Length: 123 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
APEC5202_RS19505	4000174..4000464	+	291	WP_000455798.1	HTH-type transcriptional regulator	-
APEC5202_RS19510	4000745..4000957	+	213	WP_000014594.1	RNA chaperone/antiterminator CspA	-
APEC5202_RS19515	4001145..4001297	-	153	WP_001135732.1	type I toxin-antitoxin system toxin HokA	-
APEC5202_RS19525	4002860..4003699	-	840	WP_096951086.1	DUF4942 domain-containing protein	-
APEC5202_RS19530	4003784..4003981	-	198	WP_000839243.1	DUF957 domain-containing protein	-
APEC5202_RS19535	4003993..4004481	-	489	WP_097293275.1	hypothetical protein	-
APEC5202_RS19540	4004478..4004858	-	381	WP_103529922.1	TA system toxin CbtA family protein	Toxin
APEC5202_RS19545	4004948..4005316	-	369	WP_089519525.1	type IV toxin-antitoxin system YeeU family antitoxin	Antitoxin
APEC5202_RS19550	4005366..4006010	-	645	WP_097293273.1	antitoxin of toxin-antitoxin stability system	-
APEC5202_RS19555	4006029..4006250	-	222	WP_000692300.1	DUF987 domain-containing protein	-
APEC5202_RS19560	4006313..4006789	-	477	WP_141088300.1	RadC family protein	-
APEC5202_RS19565	4006804..4007277	-	474	WP_103529921.1	antirestriction protein	-
APEC5202_RS19570	4007540..4008358	-	819	WP_103529920.1	DUF945 domain-containing protein	-
APEC5202_RS19575	4008457..4008768	-	312	WP_001556366.1	hypothetical protein	-
APEC5202_RS19580	4008788..4009078	-	291	WP_001545346.1	hypothetical protein	-
APEC5202_RS19585	4009107..4009385	-	279	WP_001545361.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	papC / papD	4001399..4049052	47653

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• CbtA toxin of type IV toxin-antitoxin system (1-112)

Antitoxin

• Antitoxin CbeA (19-117)

Sequences

Toxin

Protein

• Length: 127 a.a.
• Molecular weight: 14082.15 Da
• Isoelectric Point: 8.0567

>T288970 WP_103529922.1 NZ_LR740758:c4004858-4004478 [Escherichia coli]
MNTLPVLPGQVASSRPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINRIDILRARRATGLMTRDNYRMVNKITLGKHPEEAKQ

Nucleotide

• Length: 381 bp

Antitoxin

Protein

• Length: 123 a.a.
• Molecular weight: 13866.77 Da
• Isoelectric Point: 7.7664

>AT288970 WP_089519525.1 NZ_LR740758:c4005316-4004948 [Escherichia coli]
VSDKLHETNYPDDHNDRIWWGLPCTVTPCFGARLVQEGNRLHYLANRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSCGYVYLAVYPTSETKK

Nucleotide

• Length: 369 bp