Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3442380..3443208 Replicon chromosome
Accession NZ_LR740758
Organism Escherichia coli strain BEN5202 isolate laying hen 51 weeks old

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag APEC5202_RS16810 Protein ID WP_089643420.1
Coordinates 3442380..3442757 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2Y8PC11
Locus tag APEC5202_RS16815 Protein ID WP_001696847.1
Coordinates 3442840..3443208 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC5202_RS16780 3438518..3439864 - 1347 WP_024186110.1 IS4-like element IS4 family transposase -
APEC5202_RS16785 3439951..3440457 - 507 WP_000228937.1 G/U mismatch-specific DNA glycosylase -
APEC5202_RS16795 3440756..3441601 - 846 WP_001696810.1 DUF4942 domain-containing protein -
APEC5202_RS16800 3441686..3441883 - 198 WP_001696812.1 DUF957 domain-containing protein -
APEC5202_RS16805 3441895..3442383 - 489 WP_000761678.1 hypothetical protein -
APEC5202_RS16810 3442380..3442757 - 378 WP_089643420.1 TA system toxin CbtA family protein Toxin
APEC5202_RS16815 3442840..3443208 - 369 WP_001696847.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
APEC5202_RS16820 3443371..3443592 - 222 WP_000692357.1 DUF987 domain-containing protein -
APEC5202_RS16825 3443655..3444131 - 477 WP_001186774.1 RadC family protein -
APEC5202_RS16830 3444147..3444620 - 474 WP_001696846.1 antirestriction protein -
APEC5202_RS16835 3444962..3445780 - 819 WP_103530038.1 DUF945 domain-containing protein -
APEC5202_RS26745 3445851..3446015 + 165 WP_000504322.1 hypothetical protein -
APEC5202_RS16840 3446120..3447190 - 1071 WP_086669552.1 patatin-like phospholipase family protein -
APEC5202_RS16845 3447187..3448092 - 906 WP_001696852.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 3438518..3439846 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14076.13 Da        Isoelectric Point: 9.2315

>T288966 WP_089643420.1 NZ_LR740758:c3442757-3442380 [Escherichia coli]
MKTLPDTHVRKASRCPSPVTVWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13751.47 Da        Isoelectric Point: 5.9618

>AT288966 WP_001696847.1 NZ_LR740758:c3443208-3442840 [Escherichia coli]
VSDTLHETNYPDDNNDRSWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2Y8PC11

References