288965

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3279522..3280323 Replicon chromosome
Accession NZ_LR740758
Organism Escherichia coli strain BEN5202 isolate laying hen 51 weeks old

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag APEC5202_RS16055 Protein ID WP_001094436.1
Coordinates 3279946..3280323 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag APEC5202_RS16050 Protein ID WP_015953067.1
Coordinates 3279522..3279899 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
APEC5202_RS16015 3275434..3276114 + 681 WP_001282927.1 WYL domain-containing protein -
APEC5202_RS16020 3276262..3276939 + 678 WP_001097312.1 hypothetical protein -
APEC5202_RS16025 3276945..3277178 + 234 WP_001278287.1 DUF905 family protein -
APEC5202_RS16030 3277268..3278086 + 819 WP_001175142.1 DUF945 domain-containing protein -
APEC5202_RS16035 3278177..3278662 + 486 WP_000860054.1 antirestriction protein -
APEC5202_RS16040 3278677..3279153 + 477 WP_001186756.1 RadC family protein -
APEC5202_RS16045 3279222..3279443 + 222 WP_000692312.1 DUF987 domain-containing protein -
APEC5202_RS16050 3279522..3279899 + 378 WP_015953067.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
APEC5202_RS16055 3279946..3280323 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
APEC5202_RS16060 3280320..3280808 + 489 WP_000761714.1 hypothetical protein -
APEC5202_RS16065 3280820..3281017 + 198 WP_000839254.1 DUF957 domain-containing protein -
APEC5202_RS16070 3281102..3281947 + 846 WP_001280513.1 DUF4942 domain-containing protein -
APEC5202_RS16075 3282018..3283553 + 1536 WP_000492897.1 EAL domain-containing protein -
APEC5202_RS16080 3283950..3284120 + 171 Protein_3156 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papG / papF / papE / papK / papJ / papJ / papD / papC / papH / papA / papB / papI / kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / neuE / neuC / neuA / neuB / neuD / kpsT / kpsM / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC / rfaE 3230298..3421116 190818
- flank IS/Tn - - 3284016..3284120 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T288965 WP_001094436.1 NZ_LR740758:3279946-3280323 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT288965 WP_015953067.1 NZ_LR740758:3279522-3279899 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References