Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3279522..3280323 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | APEC5202_RS16055 | Protein ID | WP_001094436.1 |
| Coordinates | 3279946..3280323 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | APEC5202_RS16050 | Protein ID | WP_015953067.1 |
| Coordinates | 3279522..3279899 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS16015 | 3275434..3276114 | + | 681 | WP_001282927.1 | WYL domain-containing protein | - |
| APEC5202_RS16020 | 3276262..3276939 | + | 678 | WP_001097312.1 | hypothetical protein | - |
| APEC5202_RS16025 | 3276945..3277178 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| APEC5202_RS16030 | 3277268..3278086 | + | 819 | WP_001175142.1 | DUF945 domain-containing protein | - |
| APEC5202_RS16035 | 3278177..3278662 | + | 486 | WP_000860054.1 | antirestriction protein | - |
| APEC5202_RS16040 | 3278677..3279153 | + | 477 | WP_001186756.1 | RadC family protein | - |
| APEC5202_RS16045 | 3279222..3279443 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| APEC5202_RS16050 | 3279522..3279899 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| APEC5202_RS16055 | 3279946..3280323 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| APEC5202_RS16060 | 3280320..3280808 | + | 489 | WP_000761714.1 | hypothetical protein | - |
| APEC5202_RS16065 | 3280820..3281017 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| APEC5202_RS16070 | 3281102..3281947 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
| APEC5202_RS16075 | 3282018..3283553 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
| APEC5202_RS16080 | 3283950..3284120 | + | 171 | Protein_3156 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papG / papF / papE / papK / papJ / papJ / papD / papC / papH / papA / papB / papI / kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / neuE / neuC / neuA / neuB / neuD / kpsT / kpsM / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC / rfaE | 3230298..3421116 | 190818 | |
| - | flank | IS/Tn | - | - | 3284016..3284120 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T288965 WP_001094436.1 NZ_LR740758:3279946-3280323 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT288965 WP_015953067.1 NZ_LR740758:3279522-3279899 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |