Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2080126..2080957 | Replicon | chromosome |
| Accession | NZ_LR740758 | ||
| Organism | Escherichia coli strain BEN5202 isolate laying hen 51 weeks old | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | APEC5202_RS10250 | Protein ID | WP_000854814.1 |
| Coordinates | 2080583..2080957 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | APEC5202_RS10245 | Protein ID | WP_001285584.1 |
| Coordinates | 2080126..2080494 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APEC5202_RS10215 | 2077030..2077485 | + | 456 | WP_000581504.1 | hypothetical protein | - |
| APEC5202_RS10220 | 2077564..2077797 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| APEC5202_RS10225 | 2077897..2078715 | + | 819 | WP_001234629.1 | DUF945 domain-containing protein | - |
| APEC5202_RS10230 | 2078797..2079276 | + | 480 | WP_000860076.1 | antirestriction protein | - |
| APEC5202_RS10235 | 2079292..2079768 | + | 477 | WP_001186773.1 | RadC family protein | - |
| APEC5202_RS10240 | 2079831..2080052 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| APEC5202_RS10245 | 2080126..2080494 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| APEC5202_RS10250 | 2080583..2080957 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| APEC5202_RS10255 | 2080954..2081148 | + | 195 | WP_000988600.1 | hypothetical protein | - |
| APEC5202_RS10260 | 2081161..2081274 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| APEC5202_RS10265 | 2081563..2081736 | - | 174 | WP_071592185.1 | transposase domain-containing protein | - |
| APEC5202_RS10270 | 2081763..2081945 | + | 183 | WP_001016348.1 | hypothetical protein | - |
| APEC5202_RS10275 | 2082046..2082375 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| APEC5202_RS10280 | 2082547..2083605 | - | 1059 | WP_001200888.1 | FUSC family protein | - |
| APEC5202_RS10285 | 2083803..2084276 | - | 474 | WP_001105393.1 | DNA gyrase inhibitor SbmC | - |
| APEC5202_RS10290 | 2084395..2085561 | - | 1167 | WP_001513842.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T288961 WP_000854814.1 NZ_LR740758:2080583-2080957 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT288961 WP_001285584.1 NZ_LR740758:2080126-2080494 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2E8G6 |