Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 652423..653060 | Replicon | chromosome |
| Accession | NZ_LR739071 | ||
| Organism | Pseudomonas aeruginosa strain C7-25 isolate C7-25 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PERCYII40_RS03045 | Protein ID | WP_019725766.1 |
| Coordinates | 652423..652605 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PERCYII40_RS03050 | Protein ID | WP_019725767.1 |
| Coordinates | 652638..653060 (+) | Length | 141 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PERCYII40_RS03035 | 648995..649549 | - | 555 | WP_049955763.1 | hypothetical protein | - |
| PERCYII40_RS03040 | 650772..651845 | - | 1074 | WP_003121829.1 | site-specific integrase | - |
| PERCYII40_RS03045 | 652423..652605 | + | 183 | WP_019725766.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PERCYII40_RS03050 | 652638..653060 | + | 423 | WP_019725767.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PERCYII40_RS03055 | 653306..654277 | - | 972 | WP_033946036.1 | hypothetical protein | - |
| PERCYII40_RS03060 | 654262..654954 | - | 693 | WP_033946051.1 | hypothetical protein | - |
| PERCYII40_RS03065 | 654951..655493 | - | 543 | WP_025982284.1 | hypothetical protein | - |
| PERCYII40_RS03070 | 655490..656413 | - | 924 | WP_033946052.1 | hypothetical protein | - |
| PERCYII40_RS03075 | 656410..656886 | - | 477 | WP_033946054.1 | phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 625576..682659 | 57083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6970.07 Da Isoelectric Point: 10.2954
>T288943 WP_019725766.1 NZ_LR739071:652423-652605 [Pseudomonas aeruginosa]
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
MKYSEFRRWLKARGVIFEPAKGSHFKVYYGDNQTIFPDHGAKEIGDGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 14970.22 Da Isoelectric Point: 4.9047
>AT288943 WP_019725767.1 NZ_LR739071:652638-653060 [Pseudomonas aeruginosa]
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
MFDYPVTVHEEAGSVWVSCDDVPEMASAGDTVDEALLDAVEGLESALSLYVDRRQSIPLPSKGKAGQSIVRLPALTSAKI
ALWNTMLAQNVGKAELARRLGVNRVQVDRLVDLLHGSKIEAVEHALAILGQRLAVTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|