Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 956813..957470 | Replicon | chromosome |
| Accession | NZ_LR739069 | ||
| Organism | Pseudomonas aeruginosa strain PcyII-40 isolate PcyII-40 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8G3IXE4 |
| Locus tag | G3R43_RS04445 | Protein ID | WP_003098540.1 |
| Coordinates | 957288..957470 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | G3R43_RS04440 | Protein ID | WP_003124172.1 |
| Coordinates | 956813..957241 (-) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| G3R43_RS04410 | 952423..952653 | + | 231 | WP_023124259.1 | hypothetical protein | - |
| G3R43_RS04415 | 952650..953489 | + | 840 | WP_033944546.1 | helix-turn-helix domain-containing protein | - |
| G3R43_RS04420 | 953401..954285 | + | 885 | WP_191984976.1 | ATP-binding protein | - |
| G3R43_RS04425 | 954282..955679 | + | 1398 | WP_033944544.1 | AAA family ATPase | - |
| G3R43_RS04430 | 955676..955960 | + | 285 | WP_023835928.1 | hypothetical protein | - |
| G3R43_RS04435 | 955957..956514 | + | 558 | WP_015980945.1 | hypothetical protein | - |
| G3R43_RS04440 | 956813..957241 | - | 429 | WP_003124172.1 | hypothetical protein | Antitoxin |
| G3R43_RS04445 | 957288..957470 | - | 183 | WP_003098540.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| G3R43_RS04450 | 957671..957985 | + | 315 | WP_015649339.1 | phage holin, lambda family | - |
| G3R43_RS04455 | 957985..958602 | + | 618 | WP_023465046.1 | glycoside hydrolase family 19 protein | - |
| G3R43_RS04460 | 958602..959072 | + | 471 | WP_023465047.1 | lysis system i-spanin subunit Rz | - |
| G3R43_RS04465 | 959069..959812 | + | 744 | WP_023835830.1 | hypothetical protein | - |
| G3R43_RS04470 | 959964..960509 | + | 546 | WP_003159067.1 | terminase small subunit | - |
| G3R43_RS04475 | 960481..962445 | + | 1965 | WP_023086966.1 | phage terminase large subunit family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 931396..980492 | 49096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6746.86 Da Isoelectric Point: 11.0775
>T288936 WP_003098540.1 NZ_LR739069:c957470-957288 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
Download Length: 183 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15770.97 Da Isoelectric Point: 4.6562
>AT288936 WP_003124172.1 NZ_LR739069:c957241-956813 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|