Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 956813..957470 Replicon chromosome
Accession NZ_LR739069
Organism Pseudomonas aeruginosa strain PcyII-40 isolate PcyII-40

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag G3R43_RS04445 Protein ID WP_003098540.1
Coordinates 957288..957470 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag G3R43_RS04440 Protein ID WP_003124172.1
Coordinates 956813..957241 (-) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G3R43_RS04410 952423..952653 + 231 WP_023124259.1 hypothetical protein -
G3R43_RS04415 952650..953489 + 840 WP_033944546.1 helix-turn-helix domain-containing protein -
G3R43_RS04420 953401..954285 + 885 WP_191984976.1 ATP-binding protein -
G3R43_RS04425 954282..955679 + 1398 WP_033944544.1 AAA family ATPase -
G3R43_RS04430 955676..955960 + 285 WP_023835928.1 hypothetical protein -
G3R43_RS04435 955957..956514 + 558 WP_015980945.1 hypothetical protein -
G3R43_RS04440 956813..957241 - 429 WP_003124172.1 hypothetical protein Antitoxin
G3R43_RS04445 957288..957470 - 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
G3R43_RS04450 957671..957985 + 315 WP_015649339.1 phage holin, lambda family -
G3R43_RS04455 957985..958602 + 618 WP_023465046.1 glycoside hydrolase family 19 protein -
G3R43_RS04460 958602..959072 + 471 WP_023465047.1 lysis system i-spanin subunit Rz -
G3R43_RS04465 959069..959812 + 744 WP_023835830.1 hypothetical protein -
G3R43_RS04470 959964..960509 + 546 WP_003159067.1 terminase small subunit -
G3R43_RS04475 960481..962445 + 1965 WP_023086966.1 phage terminase large subunit family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 931396..980492 49096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-78)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T288936 WP_003098540.1 NZ_LR739069:c957470-957288 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 15770.97 Da        Isoelectric Point: 4.6562

>AT288936 WP_003124172.1 NZ_LR739069:c957241-956813 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References