Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 5355675..5356315 Replicon chromosome
Accession NZ_LR739068
Organism Pseudomonas aeruginosa strain PcyII-29 isolate PcyII-29

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag G3R42_RS24890 Protein ID WP_003105740.1
Coordinates 5355675..5356085 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID Q6X2S2
Locus tag G3R42_RS24895 Protein ID WP_003158175.1
Coordinates 5356085..5356315 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G3R42_RS24850 5351517..5351714 + 198 WP_003105756.1 hypothetical protein -
G3R42_RS24855 5351870..5352598 + 729 WP_003105754.1 TIGR03761 family integrating conjugative element protein -
G3R42_RS24860 5352604..5353152 + 549 WP_003105753.1 DUF3158 family protein -
G3R42_RS24865 5353199..5354038 + 840 WP_003105750.1 Rha family transcriptional regulator -
G3R42_RS24870 5354068..5354556 + 489 WP_003105748.1 single-stranded DNA-binding protein -
G3R42_RS24875 5354664..5354909 + 246 WP_023102333.1 CrpP family protein -
G3R42_RS24880 5354975..5355193 - 219 WP_003105747.1 hypothetical protein -
G3R42_RS24885 5355393..5355653 - 261 WP_003105742.1 hypothetical protein -
G3R42_RS24890 5355675..5356085 - 411 WP_003105740.1 tRNA(fMet)-specific endonuclease VapC Toxin
G3R42_RS24895 5356085..5356315 - 231 WP_003158175.1 antitoxin Antitoxin
G3R42_RS24900 5356571..5358490 + 1920 WP_004352838.1 type I DNA topoisomerase -
G3R42_RS24905 5358798..5359007 + 210 WP_003105733.1 cold-shock protein -
G3R42_RS24910 5359228..5361117 + 1890 WP_003105732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 5336104..5439401 103297


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15450.81 Da        Isoelectric Point: 7.3233

>T288933 WP_003105740.1 NZ_LR739068:c5356085-5355675 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8480.41 Da        Isoelectric Point: 4.2821

>AT288933 WP_003158175.1 NZ_LR739068:c5356315-5356085 [Pseudomonas aeruginosa]
MEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVVVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB Q6X2S2

References