Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
| Location | 3207529..3208093 | Replicon | chromosome |
| Accession | NZ_LR738849 | ||
| Organism | Desulfovibrio sp. 86 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DESU86_RS13160 | Protein ID | WP_179981445.1 |
| Coordinates | 3207529..3207852 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | DESU86_RS13165 | Protein ID | WP_179981446.1 |
| Coordinates | 3207839..3208093 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DESU86_RS13145 | 3202686..3203423 | + | 738 | WP_179981442.1 | DotI/IcmL/TraM family protein | - |
| DESU86_RS13150 | 3203423..3206401 | + | 2979 | WP_179981443.1 | type IV secretion protein IcmB | - |
| DESU86_RS13155 | 3206398..3207498 | + | 1101 | WP_179981444.1 | hypothetical protein | - |
| DESU86_RS13160 | 3207529..3207852 | - | 324 | WP_179981445.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DESU86_RS13165 | 3207839..3208093 | - | 255 | WP_179981446.1 | hypothetical protein | Antitoxin |
| DESU86_RS13170 | 3208182..3210230 | + | 2049 | WP_179981447.1 | DotA/TraY family protein | - |
| DESU86_RS13175 | 3210233..3210673 | + | 441 | WP_179981448.1 | hypothetical protein | - |
| DESU86_RS13180 | 3210641..3210943 | - | 303 | WP_179981449.1 | hypothetical protein | - |
| DESU86_RS13185 | 3210933..3211715 | - | 783 | WP_179981450.1 | ParA family protein | - |
| DESU86_RS13190 | 3211849..3212319 | + | 471 | WP_179981451.1 | DotD/TraH family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3196477..3262136 | 65659 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11394.48 Da Isoelectric Point: 8.9354
>T288928 WP_179981445.1 NZ_LR738849:c3207852-3207529 [Desulfovibrio sp. 86]
MQRGEVWWVNFDPSQGMEIQKCRPAVILTVNALNKARGTVVVVPLSTSAKPRPPIVVPLDSAGAGSVAVCDQLCAADKKR
FGKKLCDLSAADLATLTESMKIVLGLM
MQRGEVWWVNFDPSQGMEIQKCRPAVILTVNALNKARGTVVVVPLSTSAKPRPPIVVPLDSAGAGSVAVCDQLCAADKKR
FGKKLCDLSAADLATLTESMKIVLGLM
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|