Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1918467..1919082 | Replicon | chromosome |
Accession | NZ_LR738724 | ||
Organism | Streptococcus suis isolate 9401240 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | GPW69_RS09280 | Protein ID | WP_171841470.1 |
Coordinates | 1918467..1918802 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | GPW69_RS09285 | Protein ID | WP_074391634.1 |
Coordinates | 1918795..1919082 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GPW69_RS09260 | 1913712..1915055 | - | 1344 | WP_074391637.1 | cysteine--tRNA ligase | - |
GPW69_RS09270 | 1915325..1915942 | - | 618 | WP_015647409.1 | serine O-acetyltransferase | - |
GPW69_RS09275 | 1915996..1918215 | - | 2220 | WP_074391636.1 | polyribonucleotide nucleotidyltransferase | - |
GPW69_RS09280 | 1918467..1918802 | - | 336 | WP_171841470.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
GPW69_RS09285 | 1918795..1919082 | - | 288 | WP_074391634.1 | hypothetical protein | Antitoxin |
GPW69_RS09290 | 1919396..1919665 | - | 270 | WP_002938849.1 | 30S ribosomal protein S15 | - |
GPW69_RS09295 | 1919868..1921145 | - | 1278 | WP_074391633.1 | NCS2 family nucleobase:cation symporter | - |
GPW69_RS09300 | 1921364..1921837 | - | 474 | WP_074391632.1 | hypothetical protein | - |
GPW69_RS09305 | 1921818..1922036 | - | 219 | WP_074391631.1 | helix-turn-helix transcriptional regulator | - |
GPW69_RS09310 | 1922190..1922699 | - | 510 | WP_044758680.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12849.88 Da Isoelectric Point: 9.1835
>T288926 WP_171841470.1 NZ_LR738724:c1918802-1918467 [Streptococcus suis]
MDKYQVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGQLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
MDKYQVNLPLAIYEELADIRSYIREELKSPDAADKKIQELIAGLRSLEIFPERGFNVDERSKKGQLVPGQLTRGLPIKKD
YIAIYNIDEAQKVVNVRYLVASKSDYMRLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|