Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2058035..2058641 Replicon chromosome
Accession NZ_LR738723
Organism Streptococcus suis isolate GD-0088

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag GPW68_RS10255 Protein ID WP_012775364.1
Coordinates 2058035..2058364 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag GPW68_RS10260 Protein ID WP_012028535.1
Coordinates 2058354..2058641 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPW68_RS10225 2053447..2055177 - 1731 WP_012775361.1 membrane protein -
GPW68_RS10230 2055542..2056450 - 909 WP_012027884.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
GPW68_RS10235 2056434..2056964 - 531 WP_009910909.1 DUF1697 domain-containing protein -
GPW68_RS10240 2056978..2057235 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
GPW68_RS10245 2057237..2057497 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
GPW68_RS10250 2057573..2058028 - 456 WP_012028534.1 8-oxo-dGTP diphosphatase -
GPW68_RS10255 2058035..2058364 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GPW68_RS10260 2058354..2058641 - 288 WP_012028535.1 hypothetical protein Antitoxin
GPW68_RS10265 2058739..2059107 - 369 WP_012775453.1 hypothetical protein -
GPW68_RS10270 2059100..2059669 - 570 WP_012775700.1 ribonuclease M5 -
GPW68_RS10275 2059653..2060435 - 783 WP_012028536.1 TatD family hydrolase -
GPW68_RS10280 2060542..2060679 - 138 WP_002939016.1 50S ribosomal protein L34 -
GPW68_RS10285 2060847..2061842 - 996 WP_012775367.1 protein jag -
GPW68_RS10290 2061862..2062674 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
GPW68_RS10295 2062658..2063017 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2035232..2060435 25203
- flank IS/Tn - - 2063557..2064759 1202


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T288920 WP_012775364.1 NZ_LR738723:c2058364-2058035 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT288920 WP_012028535.1 NZ_LR738723:c2058641-2058354 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References