Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 2058035..2058641 | Replicon | chromosome |
| Accession | NZ_LR738723 | ||
| Organism | Streptococcus suis isolate GD-0088 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
| Locus tag | GPW68_RS10255 | Protein ID | WP_012775364.1 |
| Coordinates | 2058035..2058364 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | D5AKB4 |
| Locus tag | GPW68_RS10260 | Protein ID | WP_012028535.1 |
| Coordinates | 2058354..2058641 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPW68_RS10225 | 2053447..2055177 | - | 1731 | WP_012775361.1 | membrane protein | - |
| GPW68_RS10230 | 2055542..2056450 | - | 909 | WP_012027884.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| GPW68_RS10235 | 2056434..2056964 | - | 531 | WP_009910909.1 | DUF1697 domain-containing protein | - |
| GPW68_RS10240 | 2056978..2057235 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
| GPW68_RS10245 | 2057237..2057497 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| GPW68_RS10250 | 2057573..2058028 | - | 456 | WP_012028534.1 | 8-oxo-dGTP diphosphatase | - |
| GPW68_RS10255 | 2058035..2058364 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| GPW68_RS10260 | 2058354..2058641 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
| GPW68_RS10265 | 2058739..2059107 | - | 369 | WP_012775453.1 | hypothetical protein | - |
| GPW68_RS10270 | 2059100..2059669 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
| GPW68_RS10275 | 2059653..2060435 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
| GPW68_RS10280 | 2060542..2060679 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| GPW68_RS10285 | 2060847..2061842 | - | 996 | WP_012775367.1 | protein jag | - |
| GPW68_RS10290 | 2061862..2062674 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
| GPW68_RS10295 | 2062658..2063017 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2035232..2060435 | 25203 | |
| - | flank | IS/Tn | - | - | 2063557..2064759 | 1202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T288920 WP_012775364.1 NZ_LR738723:c2058364-2058035 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z9A6F4 |