Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1627257..1627931 | Replicon | chromosome |
| Accession | NZ_LR738723 | ||
| Organism | Streptococcus suis isolate GD-0088 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A123U128 |
| Locus tag | GPW68_RS08165 | Protein ID | WP_009910449.1 |
| Coordinates | 1627257..1627439 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A123TH46 |
| Locus tag | GPW68_RS08170 | Protein ID | WP_023371005.1 |
| Coordinates | 1627479..1627931 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPW68_RS08135 | 1622549..1622821 | + | 273 | WP_041179486.1 | DNA-binding protein | - |
| GPW68_RS08140 | 1622818..1623681 | + | 864 | WP_023370995.1 | primase alpha helix C-terminal domain-containing protein | - |
| GPW68_RS08145 | 1623678..1625201 | + | 1524 | WP_023370997.1 | DNA primase family protein | - |
| GPW68_RS08150 | 1625536..1625976 | + | 441 | WP_023370999.1 | hypothetical protein | - |
| GPW68_RS08155 | 1626046..1626546 | + | 501 | WP_023371001.1 | hypothetical protein | - |
| GPW68_RS08160 | 1626687..1627073 | + | 387 | WP_023371003.1 | hypothetical protein | - |
| GPW68_RS08165 | 1627257..1627439 | + | 183 | WP_009910449.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| GPW68_RS08170 | 1627479..1627931 | + | 453 | WP_023371005.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| GPW68_RS08175 | 1628043..1628252 | + | 210 | WP_023371007.1 | hypothetical protein | - |
| GPW68_RS08180 | 1628904..1629653 | - | 750 | WP_074389148.1 | hypothetical protein | - |
| GPW68_RS08185 | 1629730..1630524 | - | 795 | WP_024405643.1 | hypothetical protein | - |
| GPW68_RS08190 | 1630526..1630843 | - | 318 | WP_024405642.1 | PadR family transcriptional regulator | - |
| GPW68_RS08195 | 1630840..1631004 | - | 165 | WP_024405641.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1617304..1631004 | 13700 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6681.93 Da Isoelectric Point: 10.8207
>T288918 WP_009910449.1 NZ_LR738723:1627257-1627439 [Streptococcus suis]
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTAHGWTKTKGGKGSHVKLEKVGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16685.68 Da Isoelectric Point: 4.0098
>AT288918 WP_023371005.1 NZ_LR738723:1627479-1627931 [Streptococcus suis]
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGANAPYFVTFPDFEHSATQGEDMADAMAMASDWLGIHLADYIENGRDIPTPTPINALSLADNNPF
RDDKDIELVYDPSKSFVSMVMVDVAEYLGSQEPVKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123U128 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A123TH46 |