Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1954693..1955299 | Replicon | chromosome |
Accession | NZ_LR738722 | ||
Organism | Streptococcus suis isolate 861160 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
Locus tag | STREPSUIS_RS09725 | Protein ID | WP_012775364.1 |
Coordinates | 1954693..1955022 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | D5AKB4 |
Locus tag | STREPSUIS_RS09730 | Protein ID | WP_012028535.1 |
Coordinates | 1955012..1955299 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
STREPSUIS_RS09695 | 1951548..1952021 | - | 474 | WP_024378560.1 | IS200/IS605 family transposase | - |
STREPSUIS_RS09700 | 1952201..1953073 | - | 873 | WP_024387385.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
STREPSUIS_RS09705 | 1953092..1953622 | - | 531 | WP_074390182.1 | DUF1697 domain-containing protein | - |
STREPSUIS_RS09710 | 1953636..1953893 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
STREPSUIS_RS09715 | 1953895..1954155 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
STREPSUIS_RS09720 | 1954231..1954686 | - | 456 | WP_074390181.1 | 8-oxo-dGTP diphosphatase | - |
STREPSUIS_RS09725 | 1954693..1955022 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
STREPSUIS_RS09730 | 1955012..1955299 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
STREPSUIS_RS09735 | 1955397..1955765 | - | 369 | WP_012775453.1 | hypothetical protein | - |
STREPSUIS_RS09740 | 1955758..1956327 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
STREPSUIS_RS09745 | 1956311..1957093 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
STREPSUIS_RS09750 | 1957200..1957337 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
STREPSUIS_RS09755 | 1957505..1958500 | - | 996 | WP_012775367.1 | protein jag | - |
STREPSUIS_RS09760 | 1958520..1959332 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
STREPSUIS_RS09765 | 1959316..1959675 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1930213..1957093 | 26880 | |
- | flank | IS/Tn | - | - | 1951548..1952021 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T288914 WP_012775364.1 NZ_LR738722:c1955022-1954693 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z9A6F4 |