288908

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 572236..572719 Replicon chromosome
Accession NZ_LR738722
Organism Streptococcus suis isolate 861160

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag STREPSUIS_RS03080 Protein ID WP_012027435.1
Coordinates 572459..572719 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag STREPSUIS_RS03075 Protein ID WP_012775256.1
Coordinates 572236..572457 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
STREPSUIS_RS03030 567459..567641 + 183 WP_024405996.1 hypothetical protein -
STREPSUIS_RS03035 567847..568344 + 498 Protein_544 hypothetical protein -
STREPSUIS_RS03040 568391..568819 + 429 WP_074389766.1 replication protein -
STREPSUIS_RS03045 568827..569138 + 312 WP_024405994.1 hypothetical protein -
STREPSUIS_RS03050 569156..569569 + 414 WP_024405993.1 hypothetical protein -
STREPSUIS_RS03055 569659..569823 + 165 WP_079266802.1 hypothetical protein -
STREPSUIS_RS03060 570309..570491 + 183 WP_015647112.1 type II toxin-antitoxin system HicA family toxin -
STREPSUIS_RS03065 570531..570983 + 453 WP_074389768.1 type II toxin-antitoxin system HicB family antitoxin -
STREPSUIS_RS03070 571097..571306 + 210 WP_015647110.1 hypothetical protein -
STREPSUIS_RS03075 572236..572457 + 222 WP_012775256.1 hypothetical protein Antitoxin
STREPSUIS_RS03080 572459..572719 + 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
STREPSUIS_RS03085 572886..573527 + 642 WP_023370899.1 HAD family hydrolase -
STREPSUIS_RS03090 573560..573745 - 186 WP_002935693.1 hypothetical protein -
STREPSUIS_RS03095 573809..574813 - 1005 WP_023370897.1 lactonase family protein -
STREPSUIS_RS03100 574949..576115 + 1167 WP_012775254.1 AI-2E family transporter -
STREPSUIS_RS03105 576105..577334 + 1230 WP_023370895.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 561800..580404 18604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T288908 WP_012027435.1 NZ_LR738722:572459-572719 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT288908 WP_012775256.1 NZ_LR738722:572236-572457 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References