Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 570309..570983 | Replicon | chromosome |
| Accession | NZ_LR738722 | ||
| Organism | Streptococcus suis isolate 861160 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | STREPSUIS_RS03060 | Protein ID | WP_015647112.1 |
| Coordinates | 570309..570491 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | STREPSUIS_RS03065 | Protein ID | WP_074389768.1 |
| Coordinates | 570531..570983 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STREPSUIS_RS03020 | 565428..566180 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| STREPSUIS_RS03025 | 566190..567017 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| STREPSUIS_RS03030 | 567459..567641 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| STREPSUIS_RS03035 | 567847..568344 | + | 498 | Protein_544 | hypothetical protein | - |
| STREPSUIS_RS03040 | 568391..568819 | + | 429 | WP_074389766.1 | replication protein | - |
| STREPSUIS_RS03045 | 568827..569138 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| STREPSUIS_RS03050 | 569156..569569 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| STREPSUIS_RS03055 | 569659..569823 | + | 165 | WP_079266802.1 | hypothetical protein | - |
| STREPSUIS_RS03060 | 570309..570491 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| STREPSUIS_RS03065 | 570531..570983 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| STREPSUIS_RS03070 | 571097..571306 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| STREPSUIS_RS03075 | 572236..572457 | + | 222 | WP_012775256.1 | hypothetical protein | - |
| STREPSUIS_RS03080 | 572459..572719 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| STREPSUIS_RS03085 | 572886..573527 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| STREPSUIS_RS03090 | 573560..573745 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| STREPSUIS_RS03095 | 573809..574813 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 561800..580404 | 18604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T288907 WP_015647112.1 NZ_LR738722:570309-570491 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT288907 WP_074389768.1 NZ_LR738722:570531-570983 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|