288897

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 766990..767533 Replicon chromosome
Accession NZ_LR738720
Organism Streptococcus suis isolate GD-0001

Toxin (Protein)


Gene name zeta Uniprot ID A0A1X9I2P4
Locus tag GPW48_RS04055 Protein ID WP_002943355.1
Coordinates 767264..767533 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag GPW48_RS04050 Protein ID WP_002326825.1
Coordinates 766990..767262 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPW48_RS04000 762265..762495 + 231 WP_000659121.1 hypothetical protein -
GPW48_RS04005 762566..762757 + 192 WP_000503424.1 hypothetical protein -
GPW48_RS04010 762811..763911 + 1101 Protein_728 recombinase family protein -
GPW48_RS04015 764003..764242 + 240 WP_000635249.1 peptide-binding protein -
GPW48_RS04020 764291..764344 + 54 WP_117115223.1 23S rRNA methyltransferase attenuation leader peptide -
GPW48_RS04025 764499..765236 + 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
GPW48_RS04035 765406..765666 + 261 Protein_732 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
GPW48_RS04040 765769..766665 + 897 WP_002326827.1 ParA family protein -
GPW48_RS04045 766763..766972 + 210 WP_000527318.1 peptide-binding protein -
GPW48_RS04050 766990..767262 + 273 WP_002326825.1 antitoxin Antitoxin
GPW48_RS04055 767264..767533 + 270 WP_002943355.1 zeta toxin family protein Toxin
GPW48_RS04060 767631..767952 + 322 Protein_737 DUF4368 domain-containing protein -
GPW48_RS04065 767945..768904 + 960 Protein_738 hypothetical protein -
GPW48_RS04070 768975..769274 + 300 WP_024401832.1 hypothetical protein -
GPW48_RS04075 769288..769578 + 291 WP_002935084.1 hypothetical protein -
GPW48_RS04080 769674..770312 + 639 WP_002936427.1 hypothetical protein -
GPW48_RS04085 770351..771427 + 1077 WP_074390201.1 toprim domain-containing protein -
GPW48_RS04090 771481..771708 + 228 WP_000110921.1 hypothetical protein -
GPW48_RS04095 771705..772094 + 390 WP_074390200.1 chemotaxis protein -
GPW48_RS04100 772144..772434 + 291 WP_000667953.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(O/32/O) / erm(B) neuB 659972..772867 112895


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(27-75)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 9999.08 Da        Isoelectric Point: 8.7696

>T288897 WP_002943355.1 NZ_LR738720:767264-767533 [Streptococcus suis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPRSTFAN
VNKRNNFNS

Download         Length: 270 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT288897 WP_002326825.1 NZ_LR738720:766990-767262 [Streptococcus suis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9I2P4

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References