Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 572237..572720 Replicon chromosome
Accession NZ_LR738720
Organism Streptococcus suis isolate GD-0001

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag GPW48_RS03080 Protein ID WP_012027435.1
Coordinates 572460..572720 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag GPW48_RS03075 Protein ID WP_074390084.1
Coordinates 572237..572458 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GPW48_RS03030 567460..567642 + 183 WP_024405996.1 hypothetical protein -
GPW48_RS03035 567848..568345 + 498 Protein_543 hypothetical protein -
GPW48_RS03040 568392..568820 + 429 WP_074389766.1 replication protein -
GPW48_RS03045 568828..569139 + 312 WP_024405994.1 hypothetical protein -
GPW48_RS03050 569157..569570 + 414 WP_024405993.1 hypothetical protein -
GPW48_RS03055 569660..569824 + 165 WP_079266802.1 hypothetical protein -
GPW48_RS03060 570310..570492 + 183 WP_015647112.1 type II toxin-antitoxin system HicA family toxin -
GPW48_RS03065 570532..570984 + 453 WP_074389768.1 type II toxin-antitoxin system HicB family antitoxin -
GPW48_RS03070 571098..571307 + 210 WP_015647110.1 hypothetical protein -
GPW48_RS03075 572237..572458 + 222 WP_074390084.1 translation repressor RelB Antitoxin
GPW48_RS03080 572460..572720 + 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
GPW48_RS03085 572887..573528 + 642 WP_023370899.1 HAD family hydrolase -
GPW48_RS03090 573561..573746 - 186 WP_002935693.1 hypothetical protein -
GPW48_RS03095 573810..574814 - 1005 WP_023370897.1 lactonase family protein -
GPW48_RS03100 574950..576116 + 1167 WP_012775254.1 AI-2E family transporter -
GPW48_RS03105 576106..577335 + 1230 WP_023370895.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 561801..580405 18604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-70)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T288895 WP_012027435.1 NZ_LR738720:572460-572720 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT288895 WP_074390084.1 NZ_LR738720:572237-572458 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKEIGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure

References