Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 570310..570984 | Replicon | chromosome |
| Accession | NZ_LR738720 | ||
| Organism | Streptococcus suis isolate GD-0001 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | GPW48_RS03060 | Protein ID | WP_015647112.1 |
| Coordinates | 570310..570492 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | GPW48_RS03065 | Protein ID | WP_074389768.1 |
| Coordinates | 570532..570984 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GPW48_RS03020 | 565429..566181 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| GPW48_RS03025 | 566191..567018 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| GPW48_RS03030 | 567460..567642 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| GPW48_RS03035 | 567848..568345 | + | 498 | Protein_543 | hypothetical protein | - |
| GPW48_RS03040 | 568392..568820 | + | 429 | WP_074389766.1 | replication protein | - |
| GPW48_RS03045 | 568828..569139 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| GPW48_RS03050 | 569157..569570 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| GPW48_RS03055 | 569660..569824 | + | 165 | WP_079266802.1 | hypothetical protein | - |
| GPW48_RS03060 | 570310..570492 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| GPW48_RS03065 | 570532..570984 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| GPW48_RS03070 | 571098..571307 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| GPW48_RS03075 | 572237..572458 | + | 222 | WP_074390084.1 | translation repressor RelB | - |
| GPW48_RS03080 | 572460..572720 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| GPW48_RS03085 | 572887..573528 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| GPW48_RS03090 | 573561..573746 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| GPW48_RS03095 | 573810..574814 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 561801..580405 | 18604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T288894 WP_015647112.1 NZ_LR738720:570310-570492 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT288894 WP_074389768.1 NZ_LR738720:570532-570984 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|