Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 1862361..1863163 | Replicon | chromosome |
Accession | NZ_LR735440 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0711 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GOZ26_RS09035 | Protein ID | WP_002439258.1 |
Coordinates | 1862702..1863163 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GOZ26_RS09030 | Protein ID | WP_002439260.1 |
Coordinates | 1862361..1862690 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ26_RS08995 | 1858109..1858639 | + | 531 | WP_002439277.1 | N-acetyltransferase | - |
GOZ26_RS09000 | 1858875..1859072 | + | 198 | WP_002456096.1 | hypothetical protein | - |
GOZ26_RS09005 | 1859465..1859698 | - | 234 | Protein_1674 | AAA family ATPase | - |
GOZ26_RS09010 | 1860073..1860396 | + | 324 | WP_002456098.1 | hypothetical protein | - |
GOZ26_RS09015 | 1860743..1861507 | - | 765 | WP_002439267.1 | phage regulatory protein/antirepressor Ant | - |
GOZ26_RS09020 | 1861557..1861763 | + | 207 | WP_002439266.1 | hypothetical protein | - |
GOZ26_RS12840 | 1861752..1861916 | - | 165 | WP_002439265.1 | hypothetical protein | - |
GOZ26_RS09025 | 1861913..1862167 | - | 255 | WP_002439263.1 | helix-turn-helix domain-containing protein | - |
GOZ26_RS09030 | 1862361..1862690 | + | 330 | WP_002439260.1 | helix-turn-helix domain-containing protein | Antitoxin |
GOZ26_RS09035 | 1862702..1863163 | + | 462 | WP_002439258.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
GOZ26_RS09040 | 1863179..1863697 | + | 519 | WP_002439256.1 | hypothetical protein | - |
GOZ26_RS09045 | 1863699..1864142 | + | 444 | WP_002439254.1 | hypothetical protein | - |
GOZ26_RS09050 | 1864215..1864409 | + | 195 | WP_002439253.1 | hypothetical protein | - |
GOZ26_RS09055 | 1864478..1864993 | + | 516 | WP_002439252.1 | hypothetical protein | - |
GOZ26_RS09060 | 1864995..1865330 | + | 336 | WP_002439251.1 | hypothetical protein | - |
GOZ26_RS09065 | 1865386..1865982 | + | 597 | WP_002439250.1 | phage integrase SAM-like domain-containing protein | - |
GOZ26_RS12845 | 1865986..1866450 | + | 465 | Protein_1688 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1856564..1910252 | 53688 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18370.06 Da Isoelectric Point: 6.8511
>T288893 WP_002439258.1 NZ_LR735440:1862702-1863163 [Staphylococcus epidermidis]
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYENALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYENALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|