Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_26(antitoxin) |
Location | 2291009..2291803 | Replicon | chromosome |
Accession | NZ_LR735437 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0723 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GOZ17_RS11250 | Protein ID | WP_049371062.1 |
Coordinates | 2291333..2291803 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | GOZ17_RS11245 | Protein ID | WP_053091513.1 |
Coordinates | 2291009..2291320 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ17_RS11205 | 2286642..2287316 | - | 675 | WP_002439166.1 | hypothetical protein | - |
GOZ17_RS11210 | 2287330..2287752 | - | 423 | WP_155976054.1 | single-stranded DNA-binding protein | - |
GOZ17_RS11215 | 2287752..2288396 | - | 645 | WP_002439164.1 | ERF family protein | - |
GOZ17_RS11220 | 2288389..2288613 | - | 225 | WP_001830261.1 | DUF2483 family protein | - |
GOZ17_RS11225 | 2288585..2288860 | - | 276 | WP_021298917.1 | chordopoxvirus fusion protein | - |
GOZ17_RS12925 | 2289194..2289358 | - | 165 | WP_002502886.1 | hypothetical protein | - |
GOZ17_RS11230 | 2289372..2290124 | - | 753 | WP_002502887.1 | phage antirepressor KilAC domain-containing protein | - |
GOZ17_RS11235 | 2290137..2290583 | - | 447 | WP_155976055.1 | hypothetical protein | - |
GOZ17_RS11240 | 2290622..2290840 | - | 219 | WP_049401132.1 | hypothetical protein | - |
GOZ17_RS11245 | 2291009..2291320 | + | 312 | WP_053091513.1 | helix-turn-helix domain-containing protein | Antitoxin |
GOZ17_RS11250 | 2291333..2291803 | + | 471 | WP_049371062.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
GOZ17_RS11255 | 2291800..2292615 | + | 816 | WP_049371064.1 | DUF5067 domain-containing protein | - |
GOZ17_RS11260 | 2292666..2294042 | + | 1377 | WP_155976056.1 | recombinase family protein | - |
GOZ17_RS11265 | 2294069..2295271 | + | 1203 | Protein_2105 | FAD-dependent oxidoreductase | - |
GOZ17_RS11270 | 2295596..2295937 | - | 342 | WP_002438738.1 | DUF1450 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2250150..2294042 | 43892 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 18483.74 Da Isoelectric Point: 5.3066
>T288888 WP_049371062.1 NZ_LR735437:2291333-2291803 [Staphylococcus epidermidis]
VGKYEDLMIKYDHLPITETKYMPDFMSGLYLDGEIFINDNRSVRQKLETLAEEIAHHKLTHGNITNSDEYNNRKFENYAR
RYAKETVISLDGLIEAHRRGINSLYELSEFFEVTEEYVLDCLNHYKSKYGLSVIHDDYTIYFEPLSVIKNKRRDAE
VGKYEDLMIKYDHLPITETKYMPDFMSGLYLDGEIFINDNRSVRQKLETLAEEIAHHKLTHGNITNSDEYNNRKFENYAR
RYAKETVISLDGLIEAHRRGINSLYELSEFFEVTEEYVLDCLNHYKSKYGLSVIHDDYTIYFEPLSVIKNKRRDAE
Download Length: 471 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|