Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 921724..922253 | Replicon | chromosome |
Accession | NZ_LR735437 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0723 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | GOZ17_RS04425 | Protein ID | WP_001829891.1 |
Coordinates | 921891..922253 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | GOZ17_RS04420 | Protein ID | WP_001829931.1 |
Coordinates | 921724..921894 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ17_RS04395 | 917548..918027 | + | 480 | WP_002469586.1 | PH domain-containing protein | - |
GOZ17_RS04400 | 918020..919525 | + | 1506 | WP_002457110.1 | PH domain-containing protein | - |
GOZ17_RS04405 | 919512..920021 | + | 510 | WP_002457109.1 | PH domain-containing protein | - |
GOZ17_RS04410 | 920069..920422 | + | 354 | WP_002457108.1 | holo-ACP synthase | - |
GOZ17_RS04415 | 920489..921637 | + | 1149 | WP_002457107.1 | alanine racemase | - |
GOZ17_RS04420 | 921724..921894 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
GOZ17_RS04425 | 921891..922253 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
GOZ17_RS04430 | 922598..923599 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
GOZ17_RS04435 | 923699..924025 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
GOZ17_RS04440 | 924027..924500 | + | 474 | WP_002469585.1 | anti-sigma B factor RsbW | - |
GOZ17_RS04445 | 924475..925245 | + | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T288886 WP_001829891.1 NZ_LR735437:921891-922253 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |