Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 994705..995489 | Replicon | chromosome |
| Accession | NZ_LR735429 | ||
| Organism | Staphylococcus epidermidis strain none isolate Se_BPH0704 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | GOZ23_RS04910 | Protein ID | WP_145450220.1 |
| Coordinates | 995328..995489 (+) | Length | 54 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | A0A0E1VBD1 |
| Locus tag | GOZ23_RS04905 | Protein ID | WP_002446763.1 |
| Coordinates | 994705..995304 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOZ23_RS04885 | 990430..991887 | + | 1458 | WP_002446767.1 | ABC transporter substrate-binding protein/permease | - |
| GOZ23_RS04890 | 991880..992602 | + | 723 | WP_002446766.1 | amino acid ABC transporter ATP-binding protein | - |
| GOZ23_RS04895 | 992950..994080 | + | 1131 | WP_002476052.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| GOZ23_RS04900 | 994077..994547 | + | 471 | WP_002446764.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| GOZ23_RS04905 | 994705..995304 | + | 600 | WP_002446763.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| GOZ23_RS04910 | 995328..995489 | + | 162 | WP_145450220.1 | hypothetical protein | Toxin |
| GOZ23_RS04915 | 995662..996066 | + | 405 | WP_145450218.1 | hypothetical protein | - |
| GOZ23_RS04920 | 996250..997635 | + | 1386 | WP_155966397.1 | class II fumarate hydratase | - |
| GOZ23_RS04925 | 998110..998592 | + | 483 | Protein_912 | transposase | - |
| GOZ23_RS04930 | 998765..999589 | - | 825 | WP_145333982.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 998281..998592 | 311 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6287.82 Da Isoelectric Point: 4.1589
>T288877 WP_145450220.1 NZ_LR735429:995328-995489 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEIR
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQPHDNEIR
Download Length: 162 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22635.54 Da Isoelectric Point: 4.9942
>AT288877 WP_002446763.1 NZ_LR735429:994705-995304 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLGKEHAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDVSVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|