Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 854267..854796 | Replicon | chromosome |
Accession | NZ_LR735429 | ||
Organism | Staphylococcus epidermidis strain none isolate Se_BPH0704 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A939SRT1 |
Locus tag | GOZ23_RS04080 | Protein ID | WP_002447757.1 |
Coordinates | 854434..854796 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | GOZ23_RS04075 | Protein ID | WP_001829931.1 |
Coordinates | 854267..854437 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GOZ23_RS04050 | 850091..850570 | + | 480 | WP_002447762.1 | PH domain-containing protein | - |
GOZ23_RS04055 | 850563..852068 | + | 1506 | WP_002447761.1 | PH domain-containing protein | - |
GOZ23_RS04060 | 852055..852573 | + | 519 | WP_002447760.1 | PH domain-containing protein | - |
GOZ23_RS04065 | 852612..852965 | + | 354 | WP_002447759.1 | holo-ACP synthase | - |
GOZ23_RS04070 | 853032..854180 | + | 1149 | WP_099774939.1 | alanine racemase | - |
GOZ23_RS04075 | 854267..854437 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
GOZ23_RS04080 | 854434..854796 | + | 363 | WP_002447757.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
GOZ23_RS04085 | 855142..856143 | + | 1002 | WP_002447756.1 | PP2C family protein-serine/threonine phosphatase | - |
GOZ23_RS04090 | 856243..856569 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
GOZ23_RS04095 | 856571..857050 | + | 480 | WP_002447755.1 | anti-sigma B factor RsbW | - |
GOZ23_RS04100 | 857025..857795 | + | 771 | WP_002447754.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13483.62 Da Isoelectric Point: 9.9522
>T288876 WP_002447757.1 NZ_LR735429:854434-854796 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSDSKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSDSKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|