Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1852372..1853174 Replicon chromosome
Accession NZ_LR735421
Organism Staphylococcus epidermidis strain none isolate Se_BPH0697

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag GOZ25_RS08900 Protein ID WP_002469232.1
Coordinates 1852713..1853174 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag GOZ25_RS08895 Protein ID WP_002439260.1
Coordinates 1852372..1852701 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GOZ25_RS08850 1847431..1847646 + 216 WP_001831694.1 NINE protein -
GOZ25_RS08855 1848189..1848719 + 531 WP_002475755.1 N-acetyltransferase -
GOZ25_RS08860 1849493..1849726 - 234 Protein_1653 AAA family ATPase -
GOZ25_RS08865 1850105..1850332 + 228 WP_002505719.1 DUF2188 domain-containing protein -
GOZ25_RS08870 1850329..1850538 - 210 WP_173019357.1 hypothetical protein -
GOZ25_RS08875 1850547..1850759 - 213 Protein_1656 DUF771 domain-containing protein -
GOZ25_RS08880 1850763..1851518 - 756 Protein_1657 phage regulatory protein/antirepressor Ant -
GOZ25_RS08885 1851568..1851774 + 207 WP_002439266.1 hypothetical protein -
GOZ25_RS12555 1851763..1851927 - 165 WP_002439265.1 hypothetical protein -
GOZ25_RS08890 1851924..1852178 - 255 WP_002505715.1 helix-turn-helix domain-containing protein -
GOZ25_RS08895 1852372..1852701 + 330 WP_002439260.1 helix-turn-helix domain-containing protein Antitoxin
GOZ25_RS08900 1852713..1853174 + 462 WP_002469232.1 ImmA/IrrE family metallo-endopeptidase Toxin
GOZ25_RS08905 1853190..1853708 + 519 WP_002505714.1 hypothetical protein -
GOZ25_RS08910 1853710..1854153 + 444 WP_002439254.1 hypothetical protein -
GOZ25_RS08915 1854226..1854420 + 195 WP_002439253.1 hypothetical protein -
GOZ25_RS08920 1854489..1855004 + 516 WP_002439252.1 hypothetical protein -
GOZ25_RS08925 1855006..1855341 + 336 WP_002439251.1 hypothetical protein -
GOZ25_RS08930 1855397..1855990 + 594 Protein_1668 phage integrase SAM-like domain-containing protein -
GOZ25_RS08935 1856606..1857784 + 1179 WP_155978672.1 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1846644..1857784 11140
- flank IS/Tn - - 1856711..1857784 1073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(25-119)

Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18327.03 Da        Isoelectric Point: 6.8511

>T288872 WP_002469232.1 NZ_LR735421:1852713-1853174 [Staphylococcus epidermidis]
MGLYEKMLIKHDYIEVRETNVMPNDLHGLWLGDLILIKRNLSETRKAEVLYEELTHHKLTYGNILDQSKFNNRKFENYAR
RYGYEAALPLRIIVEAHNYGISNLYELAEYVQLSEEYIVEILKHYKNKYGIGTHYGEYLITFDPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12735.32 Da        Isoelectric Point: 5.7917

>AT288872 WP_002439260.1 NZ_LR735421:1852372-1852701 [Staphylococcus epidermidis]
MRNNDEIITIIKSAMKEQDMSLSELARRVGVAKSAVSRYLNLTREFPLNRTEDFAKALSISTEYLLGFDKSEQQDEQPKH
RAAHLEGELTDEEWQRVLDYADYIRSKRK

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References