Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 984336..985138 | Replicon | chromosome |
| Accession | NZ_LR735421 | ||
| Organism | Staphylococcus epidermidis strain none isolate Se_BPH0697 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | Q5HN83 |
| Locus tag | GOZ25_RS04855 | Protein ID | WP_002468490.1 |
| Coordinates | 984959..985138 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | GOZ25_RS04850 | Protein ID | WP_002486232.1 |
| Coordinates | 984336..984935 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GOZ25_RS04830 | 979548..981005 | + | 1458 | WP_002440300.1 | ABC transporter substrate-binding protein/permease | - |
| GOZ25_RS04835 | 980998..981720 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
| GOZ25_RS12550 | 982217..982366 | + | 150 | WP_002468809.1 | hypothetical protein | - |
| GOZ25_RS04840 | 982581..983711 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| GOZ25_RS04845 | 983708..984178 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| GOZ25_RS04850 | 984336..984935 | + | 600 | WP_002486232.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| GOZ25_RS04855 | 984959..985138 | + | 180 | WP_002468490.1 | hypothetical protein | Toxin |
| GOZ25_RS04860 | 985294..985698 | + | 405 | WP_002485605.1 | hypothetical protein | - |
| GOZ25_RS04865 | 985883..987268 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
| GOZ25_RS04870 | 987629..988453 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
| GOZ25_RS04875 | 988612..989745 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T288871 WP_002468490.1 NZ_LR735421:984959-985138 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22695.55 Da Isoelectric Point: 4.8641
>AT288871 WP_002486232.1 NZ_LR735421:984336-984935 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGNLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|