Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 134001..134632 | Replicon | plasmid 4 |
| Accession | NZ_LR723673 | ||
| Organism | Rhizobium flavum strain YW14 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | GFD27_RS22465 | Protein ID | WP_077548347.1 |
| Coordinates | 134231..134632 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | GFD27_RS22460 | Protein ID | WP_077548346.1 |
| Coordinates | 134001..134231 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GFD27_RS22440 | 130339..131214 | + | 876 | WP_077548342.1 | amino acid ABC transporter permease | - |
| GFD27_RS22445 | 131244..131999 | + | 756 | WP_172977952.1 | amino acid ABC transporter ATP-binding protein | - |
| GFD27_RS22450 | 132034..132870 | + | 837 | WP_077548344.1 | ABC transporter substrate-binding protein | - |
| GFD27_RS22455 | 132925..133818 | - | 894 | WP_077548345.1 | LysR family transcriptional regulator | - |
| GFD27_RS22460 | 134001..134231 | + | 231 | WP_077548346.1 | antitoxin | Antitoxin |
| GFD27_RS22465 | 134231..134632 | + | 402 | WP_077548347.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| GFD27_RS22470 | 135360..136940 | + | 1581 | WP_077548607.1 | ISL3-like element ISRsp8 family transposase | - |
| GFD27_RS22475 | 137344..137736 | + | 393 | Protein_134 | transposase | - |
| GFD27_RS22480 | 138014..138742 | + | 729 | WP_036588740.1 | FadR family transcriptional regulator | - |
| GFD27_RS22485 | 138924..139082 | + | 159 | WP_172977951.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..150934 | 150934 | |
| - | flank | IS/Tn | - | - | 135687..136940 | 1253 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15054.16 Da Isoelectric Point: 7.2442
>T288868 WP_077548347.1 NZ_LR723673:134231-134632 [Rhizobium flavum]
VLKYMLDTNICIFTIKNRPEQVREAFNRFHDQLCISSVSFMELIYGAEKSASPEKNFPVVEGFAARLEVLAYDEPAASHT
GQLRAELARNGTPIGPYDALIAGHARSRGLIMVTNNRREFDRVPGLRVEDWTR
VLKYMLDTNICIFTIKNRPEQVREAFNRFHDQLCISSVSFMELIYGAEKSASPEKNFPVVEGFAARLEVLAYDEPAASHT
GQLRAELARNGTPIGPYDALIAGHARSRGLIMVTNNRREFDRVPGLRVEDWTR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|