Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 3878469..3879016 | Replicon | chromosome |
Accession | NZ_LR723670 | ||
Organism | Rhizobium flavum strain YW14 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | GFD27_RS18960 | Protein ID | WP_077548944.1 |
Coordinates | 3878723..3879016 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | GFD27_RS18955 | Protein ID | WP_077548945.1 |
Coordinates | 3878469..3878723 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GFD27_RS18930 | 3873792..3874844 | - | 1053 | WP_172977877.1 | Gfo/Idh/MocA family oxidoreductase | - |
GFD27_RS18935 | 3875030..3875986 | + | 957 | WP_172977909.1 | LacI family DNA-binding transcriptional regulator | - |
GFD27_RS18940 | 3876253..3876852 | - | 600 | Protein_3725 | hypothetical protein | - |
GFD27_RS18945 | 3877670..3877924 | + | 255 | WP_077548947.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
GFD27_RS18950 | 3877921..3878343 | + | 423 | WP_077548946.1 | type II toxin-antitoxin system VapC family toxin | - |
GFD27_RS18955 | 3878469..3878723 | + | 255 | WP_077548945.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
GFD27_RS18960 | 3878723..3879016 | + | 294 | WP_077548944.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
GFD27_RS18965 | 3879153..3879851 | + | 699 | WP_077548943.1 | IS6 family transposase | - |
GFD27_RS18970 | 3879878..3880204 | + | 327 | WP_172977878.1 | EAL domain-containing protein | - |
GFD27_RS18975 | 3880224..3880886 | - | 663 | WP_077548941.1 | ankyrin repeat domain-containing protein | - |
GFD27_RS18980 | 3880883..3881176 | - | 294 | WP_077548940.1 | DUF1311 domain-containing protein | - |
GFD27_RS18985 | 3881688..3881951 | - | 264 | WP_077548939.1 | hypothetical protein | - |
GFD27_RS18990 | 3882465..3883001 | - | 537 | WP_139346292.1 | hypothetical protein | - |
GFD27_RS18995 | 3883176..3883787 | + | 612 | WP_077548937.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11104.63 Da Isoelectric Point: 6.2182
>T288867 WP_077548944.1 NZ_LR723670:3878723-3879016 [Rhizobium flavum]
MPFSLSVRAEEDIVSIAEEGIRAFGSLVAKRYHDELFAVLELIAENPRMARERHEISPSVRIHPFKAHLVVYRINEDGTV
FVIRIRHGHEDWAGDSP
MPFSLSVRAEEDIVSIAEEGIRAFGSLVAKRYHDELFAVLELIAENPRMARERHEISPSVRIHPFKAHLVVYRINEDGTV
FVIRIRHGHEDWAGDSP
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|