Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 3738469..3738998 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TI95 |
Locus tag | MBS3601_RS17370 | Protein ID | WP_003417760.1 |
Coordinates | 3738741..3738998 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0TI94 |
Locus tag | MBS3601_RS17365 | Protein ID | WP_003417757.1 |
Coordinates | 3738469..3738744 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS17340 | 3733494..3734798 | - | 1305 | WP_010950875.1 | PPE family protein | - |
MBS3601_RS17345 | 3735267..3736704 | - | 1438 | Protein_3425 | FAD-binding oxidoreductase | - |
MBS3601_RS17350 | 3736807..3737196 | + | 390 | WP_010950876.1 | DUF732 domain-containing protein | - |
MBS3601_RS17355 | 3737210..3737503 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
MBS3601_RS17360 | 3737500..3738345 | - | 846 | WP_010950877.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
MBS3601_RS17365 | 3738469..3738744 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
MBS3601_RS17370 | 3738741..3738998 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
MBS3601_RS17375 | 3739040..3740230 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
MBS3601_RS17380 | 3740347..3740715 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
MBS3601_RS17385 | 3740712..3741263 | - | 552 | WP_003417767.1 | pentapeptide repeat protein MfpA | - |
MBS3601_RS17390 | 3741270..3741851 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
MBS3601_RS17395 | 3741832..3742200 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
MBS3601_RS17400 | 3742178..3742570 | - | 393 | WP_011799344.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T288863 WP_003417760.1 NZ_LR699570:3738741-3738998 [Mycobacterium tuberculosis variant bovis]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|