Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3674976..3675650 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag MBS3601_RS17160 Protein ID WP_003417282.1
Coordinates 3674976..3675404 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag MBS3601_RS17165 Protein ID WP_003417286.1
Coordinates 3675408..3675650 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS17135 3670798..3671199 - 402 WP_003417264.1 cytidine deaminase -
MBS3601_RS17140 3671340..3671774 + 435 WP_003900017.1 succinate dehydrogenase, cytochrome b556 subunit -
MBS3601_RS17145 3671771..3672205 + 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
MBS3601_RS17150 3672334..3674106 + 1773 WP_003417273.1 succinate dehydrogenase flavoprotein subunit -
MBS3601_RS17155 3674106..3674897 + 792 WP_010950870.1 succinate dehydrogenase iron-sulfur subunit -
MBS3601_RS17160 3674976..3675404 - 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS17165 3675408..3675650 - 243 WP_003417286.1 ribbon-helix-helix domain-containing protein Antitoxin
MBS3601_RS17170 3675772..3676386 - 615 WP_003417288.1 class I SAM-dependent methyltransferase -
MBS3601_RS17175 3676383..3677048 - 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
MBS3601_RS17180 3677049..3677582 - 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
MBS3601_RS17185 3677579..3677953 - 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
MBS3601_RS17190 3678050..3679114 - 1065 WP_003913037.1 GTP 3',8-cyclase MoaA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T288862 WP_003417282.1 NZ_LR699570:c3675404-3674976 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT288862 WP_003417286.1 NZ_LR699570:c3675650-3675408 [Mycobacterium tuberculosis variant bovis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References