Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3674976..3675650 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | MBS3601_RS17160 | Protein ID | WP_003417282.1 |
Coordinates | 3674976..3675404 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | MBS3601_RS17165 | Protein ID | WP_003417286.1 |
Coordinates | 3675408..3675650 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS17135 | 3670798..3671199 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
MBS3601_RS17140 | 3671340..3671774 | + | 435 | WP_003900017.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
MBS3601_RS17145 | 3671771..3672205 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
MBS3601_RS17150 | 3672334..3674106 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
MBS3601_RS17155 | 3674106..3674897 | + | 792 | WP_010950870.1 | succinate dehydrogenase iron-sulfur subunit | - |
MBS3601_RS17160 | 3674976..3675404 | - | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS17165 | 3675408..3675650 | - | 243 | WP_003417286.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
MBS3601_RS17170 | 3675772..3676386 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
MBS3601_RS17175 | 3676383..3677048 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
MBS3601_RS17180 | 3677049..3677582 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
MBS3601_RS17185 | 3677579..3677953 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
MBS3601_RS17190 | 3678050..3679114 | - | 1065 | WP_003913037.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T288862 WP_003417282.1 NZ_LR699570:c3675404-3674976 [Mycobacterium tuberculosis variant bovis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |