Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3151794..3152481 | Replicon | chromosome |
| Accession | NZ_LR699570 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | MBS3601_RS14820 | Protein ID | WP_003414624.1 |
| Coordinates | 3152038..3152481 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | MBS3601_RS14815 | Protein ID | WP_003414620.1 |
| Coordinates | 3151794..3152051 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MBS3601_RS14795 | 3147114..3147968 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| MBS3601_RS14800 | 3148024..3149187 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| MBS3601_RS14805 | 3149204..3150418 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| MBS3601_RS14810 | 3150426..3151667 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| MBS3601_RS14815 | 3151794..3152051 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MBS3601_RS14820 | 3152038..3152481 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MBS3601_RS14825 | 3152561..3153223 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| MBS3601_RS14830 | 3153319..3153510 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| MBS3601_RS14835 | 3153842..3155590 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| MBS3601_RS14840 | 3155686..3156267 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| MBS3601_RS14845 | 3156367..3156633 | + | 267 | WP_031657293.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T288860 WP_003414624.1 NZ_LR699570:3152038-3152481 [Mycobacterium tuberculosis variant bovis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|