Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3146193..3146741 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | MBS3601_RS14790 | Protein ID | WP_003414602.1 |
Coordinates | 3146478..3146741 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | MBS3601_RS14785 | Protein ID | WP_003414599.1 |
Coordinates | 3146193..3146474 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS14760 | 3141816..3142673 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
MBS3601_RS14765 | 3142715..3143299 | - | 585 | WP_010950792.1 | DUF1707 domain-containing protein | - |
MBS3601_RS14770 | 3143403..3143651 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
MBS3601_RS14775 | 3143648..3144028 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
MBS3601_RS14780 | 3144110..3145921 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
MBS3601_RS14785 | 3146193..3146474 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
MBS3601_RS14790 | 3146478..3146741 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MBS3601_RS14795 | 3147114..3147968 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
MBS3601_RS14800 | 3148024..3149187 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
MBS3601_RS14805 | 3149204..3150418 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
MBS3601_RS14810 | 3150426..3151667 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T288859 WP_003414602.1 NZ_LR699570:3146478-3146741 [Mycobacterium tuberculosis variant bovis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|