288858

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 3105330..3105934 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag MBS3601_RS14590 Protein ID WP_069523413.1
Coordinates 3105330..3105722 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag MBS3601_RS14595 Protein ID WP_003414495.1
Coordinates 3105719..3105934 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS14560 3100480..3101268 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
MBS3601_RS14565 3101602..3102147 - 546 WP_003904931.1 DUF1802 family protein -
MBS3601_RS14570 3102419..3103303 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
MBS3601_RS14575 3103306..3104193 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
MBS3601_RS14580 3104498..3105043 - 546 WP_003899500.1 DUF1802 family protein -
MBS3601_RS14585 3105040..3105309 - 270 WP_003414489.1 DUF2277 family protein -
MBS3601_RS14590 3105330..3105722 - 393 WP_069523413.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS14595 3105719..3105934 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
MBS3601_RS14600 3105981..3106730 + 750 WP_003414497.1 enoyl-CoA hydratase -
MBS3601_RS14605 3106809..3107891 - 1083 WP_003414499.1 ABC transporter ATP-binding protein -
MBS3601_RS14610 3107884..3109194 - 1311 WP_069523411.1 ABC transporter substrate-binding protein -
MBS3601_RS14615 3109197..3110024 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
MBS3601_RS14620 3110021..3110932 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-115)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14679.85 Da        Isoelectric Point: 7.0741

>T288858 WP_069523413.1 NZ_LR699570:c3105722-3105330 [Mycobacterium tuberculosis variant bovis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRRHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT288858 WP_003414495.1 NZ_LR699570:c3105934-3105719 [Mycobacterium tuberculosis variant bovis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References