Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3077126..3077696 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | MBS3601_RS14435 | Protein ID | WP_003414166.1 |
Coordinates | 3077126..3077482 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | MBS3601_RS14440 | Protein ID | WP_003901465.1 |
Coordinates | 3077466..3077696 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS14415 | 3072578..3074266 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
MBS3601_RS14420 | 3074270..3074596 | - | 327 | WP_003414157.1 | hypothetical protein | - |
MBS3601_RS14425 | 3074769..3075356 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
MBS3601_RS14430 | 3075375..3077024 | + | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
MBS3601_RS14435 | 3077126..3077482 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
MBS3601_RS14440 | 3077466..3077696 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
MBS3601_RS14445 | 3077739..3078782 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
MBS3601_RS14450 | 3078973..3079248 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
MBS3601_RS14455 | 3079424..3079678 | - | 255 | WP_003917684.1 | hypothetical protein | - |
MBS3601_RS14460 | 3079826..3080230 | + | 405 | WP_003414181.1 | hypothetical protein | - |
MBS3601_RS14465 | 3080227..3080418 | + | 192 | WP_003414184.1 | hypothetical protein | - |
MBS3601_RS14470 | 3080482..3081771 | + | 1290 | Protein_2855 | transposase family protein | - |
MBS3601_RS14475 | 3082005..3082262 | + | 258 | WP_003899489.1 | hypothetical protein | - |
MBS3601_RS14480 | 3082367..3082678 | + | 312 | WP_010950777.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T288856 WP_003414166.1 NZ_LR699570:c3077482-3077126 [Mycobacterium tuberculosis variant bovis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|