Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3037543..3038230 | Replicon | chromosome |
Accession | NZ_LR699570 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | MBS3601_RS14225 | Protein ID | WP_003414064.1 |
Coordinates | 3037835..3038230 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | MBS3601_RS14220 | Protein ID | WP_003414061.1 |
Coordinates | 3037543..3037809 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MBS3601_RS14195 | 3033182..3034084 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
MBS3601_RS14200 | 3034153..3034905 | - | 753 | WP_069523501.1 | FAD-dependent thymidylate synthase | - |
MBS3601_RS14205 | 3035149..3035424 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
MBS3601_RS14210 | 3035421..3037043 | - | 1623 | WP_003414057.1 | type I restriction-modification system subunit M | - |
MBS3601_RS14215 | 3037130..3037546 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
MBS3601_RS14220 | 3037543..3037809 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MBS3601_RS14225 | 3037835..3038230 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MBS3601_RS14230 | 3038227..3038496 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MBS3601_RS14235 | 3038506..3039600 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
MBS3601_RS14240 | 3039597..3040016 | - | 420 | Protein_2809 | winged helix-turn-helix domain-containing protein | - |
MBS3601_RS14245 | 3040090..3040569 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
MBS3601_RS14250 | 3040640..3041440 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
MBS3601_RS14255 | 3041596..3042333 | + | 738 | WP_011799288.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T288855 WP_003414064.1 NZ_LR699570:c3038230-3037835 [Mycobacterium tuberculosis variant bovis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|