Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2907972..2908686 Replicon chromosome
Accession NZ_LR699570
Organism Mycobacterium tuberculosis variant bovis strain Mb3601 isolate 14Z005608

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag MBS3601_RS13465 Protein ID WP_003413460.1
Coordinates 2908246..2908686 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag MBS3601_RS13460 Protein ID WP_003413456.1
Coordinates 2907972..2908259 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MBS3601_RS13425 2903394..2903639 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MBS3601_RS13430 2903636..2904040 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
MBS3601_RS13435 2904257..2904877 + 621 WP_003413441.1 DUF4178 domain-containing protein -
MBS3601_RS13440 2904888..2905382 + 495 WP_003413444.1 DUF2617 family protein -
MBS3601_RS13445 2905379..2905810 + 432 WP_003413445.1 DUF4247 domain-containing protein -
MBS3601_RS13450 2905835..2906293 + 459 WP_003413451.1 DUF350 domain-containing protein -
MBS3601_RS13455 2906290..2907861 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
MBS3601_RS13460 2907972..2908259 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
MBS3601_RS13465 2908246..2908686 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
MBS3601_RS13470 2908707..2909462 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
MBS3601_RS13475 2909595..2910191 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
MBS3601_RS13480 2910199..2911044 - 846 WP_010950749.1 acyl-CoA thioesterase II -
MBS3601_RS13485 2911073..2911972 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
MBS3601_RS13490 2912100..2912774 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T288853 WP_003413460.1 NZ_LR699570:2908246-2908686 [Mycobacterium tuberculosis variant bovis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT288853 WP_003413456.1 NZ_LR699570:2907972-2908259 [Mycobacterium tuberculosis variant bovis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References